Identification
BMDB Protein ID BMDBP01907
Secondary Accession Numbers None
Name Similar to mannose-6-phosphate/insulin-like growth factor II receptor
Synonyms Not Available
Gene Name Not Available
Protein Type Enzyme
Biological Properties
General Function Involved in glycoprotein binding
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 9
Locus 9q27-q28
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues 139
Molecular Weight 15486.0
Theoretical pI 4.54
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • 52-74
Protein Sequence
>Similar to mannose-6-phosphate/insulin-like growth factor II receptor
DGIPEFSHETADCQYLFSWHTSAVCPLGAGFDEEIAGDDAQEHKGLSERSQAVGAVLSLL
LVALTACLLTLLLYKKERREMVMSRLTNCCRRSANVSYKYSKVNKEEEADENETEWLMEE
IQPPAPRPGKEGQENGHVA
GenBank ID Protein BAC56546.1
UniProtKB/Swiss-Prot ID Q862E4
UniProtKB/Swiss-Prot Entry Name Q862E4_BOVIN
PDB IDs Not Available
GenBank Gene ID AB099056
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available