Showing Protein Acrosin (BMDBP01909)
Identification | |
---|---|
BMDB Protein ID | BMDBP01909 |
Secondary Accession Numbers | None |
Name | Acrosin |
Synonyms | Not Available |
Gene Name | bovine proacrosine |
Protein Type | Enzyme |
Biological Properties | |
General Function | Cell cycle control, cell division, chromosome partitioning |
Specific Function | Acrosin is the major protease of mammalian spermatozoa. It is a serine protease of trypsin-like cleavage specificity, it is synthesized in a zymogen form, proacrosin and stored in the acrosome. |
Pathways | Not Available |
Reactions | Not Available |
GO Classification | Not Available |
Cellular Location | Not Available |
Gene Properties | |
Chromosome Location | Not Available |
Locus | 5q35 |
SNPs | bovine proacrosine |
Gene Sequence | Not Available |
Protein Properties | |
Number of Residues | 377 |
Molecular Weight | 41722.0 |
Theoretical pI | 9.96 |
Pfam Domain Function | Not Available |
Signals |
|
Transmembrane Regions |
|
Protein Sequence |
>Acrosin MRIIGGQDAAHGSWPWMVSLQIFTYHNNRRYHVCWGLLLNAHWLLTAAHCFRIKKKVTDW RLIFGAKEVEWGSNKPVKPPLQERYVEKIIIHEKYSASSEANDIALIKITPPVICGHFIG PGCLPQFRAGPPRVPQTCWVAGWGFLRENARRTSPVLQEAHVDLIDLDLCNSTRWYNGRI RSTNVCAGYPEGKIDTCQGDSGGPLMCKDSVENSYVVVGITSWGVGCSRAKRPGVYTSTW SYLNWIASKIGSNTVHMIQLPTAPPASTPAAQASPGSVQPSIRPPWFFQHVPQPPPSQQA IAVAQPSRPSSPRPSVPPAPRPPRPPPPQPSTRPPQALSFAKRLQQLIEVLKGKTFLNEK SNYEMETTGLPGQHASS |
External Links | |
GenBank ID Protein | CAA48294.1 |
UniProtKB/Swiss-Prot ID | P79343 |
UniProtKB/Swiss-Prot Entry Name | P79343_BOVIN |
PDB IDs | |
GenBank Gene ID | X68212 |
GeneCard ID | bovine proacrosine |
GenAtlas ID | Not Available |
HGNC ID | Not Available |
References | |
General References | Not Available |