Showing Protein COMM domain-containing protein 1 (BMDBP01924)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP01924 |
| Secondary Accession Numbers | None |
| Name | COMM domain-containing protein 1 |
| Synonyms | Not Available |
| Gene Name | COMMD1 |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Not Available |
| Specific Function | Proposed scaffold protein that is implicated in diverse physiological processes and whose function may be in part linked to its ability to regulate ubiquitination of specific cellular proteins. Can modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes by displacing CAND1; in vitro promotes CRL E3 activity and dissociates CAND1 from CUL1 and CUL2. Promotes ubiquitination of NF-kappa-B subunit RELA and its subsequent proteasomal degradation. Down-regulates NF-kappa-B activity. Involved in the regulation of membrane expression and ubiquitination of SLC12A2. Modulates Na(+) transport in epithelial cells by regulation of apical cell surface expression of amiloride-sensitive sodium channel (ENaC) subunits and by promoting their ubiquitination presumably involving NEDD4L. Promotes the localization of SCNN1D to recycling endosomes. Promotes CFTR cell surface expression through regulation of its ubiquitination. Down-regulates SOD1 activity by interfering with its homodimerization. Plays a role in copper ion homeostasis. Involved in copper-dependent ATP7A trafficking between the trans-Golgi network and vesicles in the cell periphery; the function is proposed to depend on its association within the CCC complex and cooperation with the WASH complex on early endosomes. Can bind one copper ion per monomer. May function to facilitate biliary copper excretion within hepatocytes. Binds to phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2). Involved in the regulation of HIF1A-mediated transcription; competes with ARNT/Hif-1-beta for binding to HIF1A resulting in decreased DNA binding and impaired transcriptional activation by HIF-1. Negatively regulates neuroblastoma G1/S phase cell cycle progression and cell proliferation by stimulating ubiquitination of NF-kappa-B subunit RELA and NF-kappa-B degradation in a FAM107A- and actin-dependent manner. |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 11 |
| Locus | Not Available |
| SNPs | COMMD1 |
| Gene Sequence |
>567 bp ATGGCGGCCGAACTTGAGGGTTCCAAGTGCCTGAGTGGGCTGTTGAGCGGCCTGGCTCAG GATACTTTCTACGGGCACCCGGGCATCACCGAGGAGCTGCTGCGAAGCCAGCTGTATCCG GAGGTGTCACTTGAGGAGTTCCGCCCCTTTCTGGCGAAGATGAAGGGGATTCTTAAGTCT ATTGCATCTGCAGACATGGATTTCAACCAGCTGGAGGCATTTTTGACTGCTCTAACCAAA AAGCAAGGAGGGATCACATCTGAGCAAGCTGCTGTCATTTCCAAGTTCTGGAAGAGCCAT AAGACAAAAATCCGAGAGAGTCTTATGAACCAGAGCTGCTGGGACAGAGGGCTTCGGAGC TTGAGCTGGAGAGTTGATGGCAAATCGCAGTCAAGACACTCAGCTCAAATACATACTCCT GTTGCCATCATGGAGCTGGAAATAGGGAAAAGTGGACAGGAATCTGAATTTCTGTGTTTG GAATTTGATGAGGTCAAGGTCAATCAAGTCCTGAAGAAGCTCTCAGAGGTAGAAGAAAGT ATCAGCACACTGATGCAACCAGCCTAG |
| Protein Properties | |
| Number of Residues | 188 |
| Molecular Weight | 20983.0 |
| Theoretical pI | 6.13 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions | Not Available |
| Protein Sequence |
>COMM domain-containing protein 1 MAAELEGSKCLSGLLSGLAQDTFYGHPGITEELLRSQLYPEVSLEEFRPFLAKMKGILKS IASADMDFNQLEAFLTALTKKQGGITSEQAAVISKFWKSHKTKIRESLMNQSCWDRGLRS LSWRVDGKSQSRHSAQIHTPVAIMELEIGKSGQESEFLCLEFDEVKVNQVLKKLSEVEES ISTLMQPA |
| External Links | |
| GenBank ID Protein | AAI11640.1 |
| UniProtKB/Swiss-Prot ID | Q2M2T5 |
| UniProtKB/Swiss-Prot Entry Name | COMD1_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | BC111639 |
| GeneCard ID | COMMD1 |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |