Showing Protein Metallothionein-1 (BMDBP01931)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP01931 |
| Secondary Accession Numbers | None |
| Name | Metallothionein-1 |
| Synonyms | Not Available |
| Gene Name | MT1 |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in cadmium ion binding |
| Specific Function | Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids. |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | Not Available |
| Locus | Not Available |
| SNPs | MT1 |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 61 |
| Molecular Weight | 5992.0 |
| Theoretical pI | 8.11 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions |
|
| Protein Sequence |
>Metallothionein-1 MDPNCSCPTGGSCTCAGSCKCKACRCPSCKKSCCSCCPVGCAKCAQGCVCKGASDKCSCC A |
| External Links | |
| GenBank ID Protein | Not Available |
| UniProtKB/Swiss-Prot ID | P58280 |
| UniProtKB/Swiss-Prot Entry Name | MT1_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | Not Available |
| GeneCard ID | MT1 |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |