Showing Protein Ferritin (BMDBP01933)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP01933 |
| Secondary Accession Numbers | None |
| Name | Ferritin |
| Synonyms | Not Available |
| Gene Name | Not Available |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in ferric iron binding |
| Specific Function | Stores iron in a soluble, non-toxic, readily available form. Important for iron homeostasis. Iron is taken up in the ferrous form and deposited as ferric hydroxides after oxidation. |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 29 |
| Locus | Not Available |
| SNPs | Not Available |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 76 |
| Molecular Weight | 9054.0 |
| Theoretical pI | 6.24 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions |
|
| Protein Sequence |
>Ferritin YFDRDDVALKNFAKYFLHQSHEEREHAERLMKLQNQRGGRIFLQDIKKPDRDDWENGLTA MECALCLERSANQSLL |
| External Links | |
| GenBank ID Protein | ABC84228.1 |
| UniProtKB/Swiss-Prot ID | A1XEB9 |
| UniProtKB/Swiss-Prot Entry Name | A1XEB9_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | DQ347591 |
| GeneCard ID | Not Available |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |