Showing Protein Ferritin (BMDBP01939)
Identification | |
---|---|
BMDB Protein ID | BMDBP01939 |
Secondary Accession Numbers | None |
Name | Ferritin |
Synonyms | Not Available |
Gene Name | Not Available |
Protein Type | Enzyme |
Biological Properties | |
General Function | Involved in ferric iron binding |
Specific Function | Stores iron in a soluble, non-toxic, readily available form. Important for iron homeostasis. Iron is taken up in the ferrous form and deposited as ferric hydroxides after oxidation. |
Pathways | Not Available |
Reactions | Not Available |
GO Classification | Not Available |
Cellular Location | Not Available |
Gene Properties | |
Chromosome Location | 29 |
Locus | Not Available |
SNPs | Not Available |
Gene Sequence | Not Available |
Protein Properties | |
Number of Residues | 123 |
Molecular Weight | 14514.0 |
Theoretical pI | 6.96 |
Pfam Domain Function | Not Available |
Signals |
|
Transmembrane Regions |
|
Protein Sequence |
>FTH1 DVSLKNFAKYFLHHSHEEREHAERLMKLQNQRRRRIFLQDIKKPDRDDWEIGLTAMECAL CSERGVNQSLLELHNWPLKKNDPHVRDFIETHYLNEQVEAIKELGDHITNLRKMGAPGSG MAE |
External Links | |
GenBank ID Protein | ABC84231.1 |
UniProtKB/Swiss-Prot ID | A1XEC2 |
UniProtKB/Swiss-Prot Entry Name | A1XEC2_BOVIN |
PDB IDs | Not Available |
GenBank Gene ID | DQ347594 |
GeneCard ID | Not Available |
GenAtlas ID | Not Available |
HGNC ID | Not Available |
References | |
General References | Not Available |