Showing Protein Folate receptor alpha (BMDBP01960)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP01960 |
| Secondary Accession Numbers | None |
| Name | Folate receptor alpha |
| Synonyms | Not Available |
| Gene Name | FOLR1 |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in folic acid binding |
| Specific Function | Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate and folate analogs into the interior of cells. Has high affinity for folate and folic acid analogs at neutral pH. Exposure to slightly acidic pH after receptor endocytosis triggers a conformation change that strongly reduces its affinity for folates and mediates their release. Required for normal embryonic development and normal cell proliferation (By similarity). |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 15 |
| Locus | Not Available |
| SNPs | FOLR1 |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 241 |
| Molecular Weight | 27922.0 |
| Theoretical pI | 7.89 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions |
|
| Protein Sequence |
>Folate receptor alpha MAWQMTQLLLLALVAAAWGAQAPRTPRARTDLLNVCMDAKHHKAEPGPEDSLHEQCSPWR KNACCSVNTSIEAHKDISYLYRFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIREVN QRWRKERVLGVPLCKEDCQSWWEDCRTSYTCKSNWHKGWNWTSGYNQCPVKAAHCRFDFY FPTPAALCNEIWSHSYKVSNYSRGSGRCIQMWFDPFQGNPNEEVARFYAENPTSGSTPQG I |
| External Links | |
| GenBank ID Protein | Not Available |
| UniProtKB/Swiss-Prot ID | P02702 |
| UniProtKB/Swiss-Prot Entry Name | FOLR1_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | DN512948 |
| GeneCard ID | FOLR1 |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |