Showing Protein ATP6V0B (BMDBP01975)
Identification | |
---|---|
BMDB Protein ID | BMDBP01975 |
Secondary Accession Numbers | None |
Name | ATP6V0B |
Synonyms | Not Available |
Gene Name | Not Available |
Protein Type | Enzyme |
Biological Properties | |
General Function | Energy production and conversion |
Specific Function | Not Available |
Pathways | Not Available |
Reactions | Not Available |
GO Classification | Not Available |
Cellular Location | Not Available |
Gene Properties | |
Chromosome Location | 3 |
Locus | Not Available |
SNPs | Not Available |
Gene Sequence | Not Available |
Protein Properties | |
Number of Residues | 200 |
Molecular Weight | 21017.0 |
Theoretical pI | 7.84 |
Pfam Domain Function | Not Available |
Signals |
|
Transmembrane Regions |
|
Protein Sequence |
>ATP6V0B LLYSGVFVAFWACLLVVGICYTIFDLGFRFDVAWFLTETSPFMWSNLGIGLAISLSVVGA AWGIYITGSSIIGGGVKAPRIKTKNLVSIIFCEAVAIYGIIMAIVISNMAEPFSATDPKA IGHRNYHAGYSMFGAGLTVGLSNLFCGVCVGIVGSGAALADAQNPSLFVKILIVEIFGSA IGLFGVIVAILQTSRVKMGD |
External Links | |
GenBank ID Protein | ABC84236.1 |
UniProtKB/Swiss-Prot ID | A1XEC7 |
UniProtKB/Swiss-Prot Entry Name | A1XEC7_BOVIN |
PDB IDs | Not Available |
GenBank Gene ID | DQ347602 |
GeneCard ID | Not Available |
GenAtlas ID | Not Available |
HGNC ID | Not Available |
References | |
General References | Not Available |