You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP01997
Secondary Accession Numbers None
Name Agouti-signaling protein
Synonyms Not Available
Gene Name ASIP
Protein Type Enzyme
Biological Properties
General Function Involved in hormone-mediated signaling
Specific Function Involved in the regulation of melanogenesis. The binding of ASP to MC1R precludes alpha-MSH initiated signaling and thus blocks production of cAMP, leading to a down-regulation of eumelanogenesis (brown/black pigment) and thus increasing synthesis of pheomelanin (yellow/red pigment) (By similarity).
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 13
Locus Not Available
SNPs ASIP
Gene Sequence Not Available
Protein Properties
Number of Residues 133
Molecular Weight 14841.0
Theoretical pI 10.03
Pfam Domain Function Not Available
Signals
  • 1-22
Transmembrane Regions Not Available
Protein Sequence
>Agouti-signaling protein
MDVSRLLLATLLVCLCFLTAYSHLAPEEKPRDERNLKNNSSMNLLDFPSVSIVALNKKSK
KISRNEAEKKKRPSKRKAPMKNVARTRPPPPTPCVATRDSCKPPAPACCDPCAFCQCRFF
RSACSCRVLNPTC
GenBank ID Protein CAA68004.1
UniProtKB/Swiss-Prot ID Q29414
UniProtKB/Swiss-Prot Entry Name ASIP_BOVIN
PDB IDs Not Available
GenBank Gene ID X99692
GeneCard ID ASIP
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available