Showing Protein Agouti-signaling protein (BMDBP01997)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP01997 |
| Secondary Accession Numbers | None |
| Name | Agouti-signaling protein |
| Synonyms | Not Available |
| Gene Name | ASIP |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in hormone-mediated signaling |
| Specific Function | Involved in the regulation of melanogenesis. The binding of ASP to MC1R precludes alpha-MSH initiated signaling and thus blocks production of cAMP, leading to a down-regulation of eumelanogenesis (brown/black pigment) and thus increasing synthesis of pheomelanin (yellow/red pigment) (By similarity). |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 13 |
| Locus | Not Available |
| SNPs | ASIP |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 133 |
| Molecular Weight | 14841.0 |
| Theoretical pI | 10.03 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions | Not Available |
| Protein Sequence |
>Agouti-signaling protein MDVSRLLLATLLVCLCFLTAYSHLAPEEKPRDERNLKNNSSMNLLDFPSVSIVALNKKSK KISRNEAEKKKRPSKRKAPMKNVARTRPPPPTPCVATRDSCKPPAPACCDPCAFCQCRFF RSACSCRVLNPTC |
| External Links | |
| GenBank ID Protein | CAA68004.1 |
| UniProtKB/Swiss-Prot ID | Q29414 |
| UniProtKB/Swiss-Prot Entry Name | ASIP_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | X99692 |
| GeneCard ID | ASIP |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |