Showing Protein Ficolin-2 (BMDBP02058)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP02058 |
| Secondary Accession Numbers | None |
| Name | Ficolin-2 |
| Synonyms | Not Available |
| Gene Name | FCN2 |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in receptor binding |
| Specific Function | May function in innate immunity through activation of the lectin complement pathway. Calcium-dependent and GlcNAc-binding lectin (By similarity). |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 11 |
| Locus | Not Available |
| SNPs | FCN2 |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 329 |
| Molecular Weight | 35339.0 |
| Theoretical pI | 7.48 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions |
|
| Protein Sequence |
>Ficolin-2 MELGGAAGALGPSGPLLVCLCFGTLAAQAADTCPEVKLVGLEGSDKLSILRGCPGLPGAP GLKGETGAAGLKGERGLPGVPGKAGPAGPKGSTGAQGEKGARGEKGESGQLHSCATGPRT CTELLTRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRKDGSVDFFRTWTAYKQ GFGSQLGEFWLGNDNIHALTAQGTSELRVDLMDFEGNHRFAKYQSFRMADEAEKYKLVLG AFVEGNAGDSLTDHGNHFFSTKDRDNDESPSNCAAQFQGAWWYHSCHSSNLNGRYLRGPH TSYANGINWKSWGRYNYSYKVSEMKLRLT |
| External Links | |
| GenBank ID Protein | AAW52550.1 |
| UniProtKB/Swiss-Prot ID | Q5I2E5 |
| UniProtKB/Swiss-Prot Entry Name | FCN2_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | AY860499 |
| GeneCard ID | FCN2 |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |