Identification
BMDB Protein ID BMDBP02094
Secondary Accession Numbers None
Name Na+ and H+ coupled amino acid transport system N1
Synonyms Not Available
Gene Name Not Available
Protein Type Enzyme
Biological Properties
General Function Amino acid transport and metabolism
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 22
Locus Not Available
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues 193
Molecular Weight 21625.0
Theoretical pI 6.76
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • 38-58
  • 65-86
  • 141-161
  • 173-192
Protein Sequence
>Na+ and H+ coupled amino acid transport system N1
AITLQNIGAMSSYLYIIKSELPLVIQTFLHLEDWTSDWYTNGNYLVILVSIVVILPLALM
RQLGYLGYSSGFSLSCMMFFLIAVIYKKFHVPCPLSPNATNVTSNISLVEIDKDEAGLQA
KTEAGAFCTPSYFTLNTQTAYTIPIMAFAFVCHPEVLPIYTELKDPSKRKMQRISNLSIA
VMYVMYFLAALFG
GenBank ID Protein AAO27469.1
UniProtKB/Swiss-Prot ID Q866Q8
UniProtKB/Swiss-Prot Entry Name Q866Q8_BOVIN
PDB IDs Not Available
GenBank Gene ID AY186584
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available