Showing Protein Islet amyloid polypeptide (BMDBP02147)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP02147 |
| Secondary Accession Numbers | None |
| Name | Islet amyloid polypeptide |
| Synonyms | Not Available |
| Gene Name | IAPP |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in hormone activity |
| Specific Function | Selectively inhibits insulin-stimulated glucose utilization and glycogen deposition in muscle, while not affecting adipocyte glucose metabolism. |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 5 |
| Locus | Not Available |
| SNPs | IAPP |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 91 |
| Molecular Weight | 9953.0 |
| Theoretical pI | 10.37 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions |
|
| Protein Sequence |
>Islet amyloid polypeptide MGILKLPVVLIVLCVALNHLEGGGKPTESHQMEKRKCGTATCETQRLANFLAPSSNKLGA IFSPTKMGSNTYGKRKKVEILKREPLSYLPI |
| External Links | |
| GenBank ID Protein | AAB05915.1 |
| UniProtKB/Swiss-Prot ID | Q28207 |
| UniProtKB/Swiss-Prot Entry Name | IAPP_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | U62626 |
| GeneCard ID | IAPP |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |