Showing Protein Multifunctional fusion protein (BMDBP02156)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP02156 |
| Secondary Accession Numbers | None |
| Name | Multifunctional fusion protein |
| Synonyms | Not Available |
| Gene Name | IL1B |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in cytokine activity |
| Specific Function | Potent proinflammatory cytokine. Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production. |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 11 |
| Locus | 11q23-q24 |
| SNPs | IL1B |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 113 |
| Molecular Weight | 13246.0 |
| Theoretical pI | 5.93 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions |
|
| Protein Sequence |
>Interleukin 1-beta VFCMSFVQGEERDNKIPVALGIKDKNLYLSCVKKGDTPTLQLEEVDPKVYPKRNMEKRFV FYKTEIKNTVEFESVLYPNWYISTSQIEERPVFLGHFRGGQDITDFRMETLSP |
| External Links | |
| GenBank ID Protein | AAW21225.1 |
| UniProtKB/Swiss-Prot ID | Q5MAC0 |
| UniProtKB/Swiss-Prot Entry Name | Q5MAC0_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | AY851162 |
| GeneCard ID | IL1B |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |