Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP02182
Secondary Accession Numbers None
Name C-C chemokine receptor type 5
Synonyms Not Available
Gene Name CCR5
Protein Type Enzyme
Biological Properties
General Function Involved in G-protein coupled receptor protein signalin
Specific Function Receptor for a number of inflammatory CC-chemokines including MIP-1-alpha, MIP-1-beta and RANTES and subsequently transduces a signal by increasing the intracellular calcium ion level. May play a role in the control of granulocytic lineage proliferation or differentiation (By similarity).
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 22
Locus Not Available
SNPs CCR5
Gene Sequence Not Available
Protein Properties
Number of Residues 352
Molecular Weight 40235.0
Theoretical pI 9.39
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • 31-58
  • 69-89
  • 103-124
  • 142-166
  • 199-218
  • 236-260
  • 278-301
Protein Sequence
>C-C chemokine receptor type 5
MDYQTSTPLYDIDYGMSEPCQKLNVRQIAARLLPPLYSLVFIFGFVGNMLVVLILINCKK
LKSMTDIYLLNLAISDLLFIITIPFWAHYAADQWVFGNTMCQLFTGFYFIGYFGGIFFII
LLTIDRYLAIVHAVFALKARTVTFGAATSVVTWVVAVFASLPGIIFTKSQKEGSRHTCSP
HFPSSQYHFWKNFQTLKIVILGLVLPLLVMIVCYSGIIKTLLRCRNEKKKHKAVRLIFVI
MIVYFLFWAPYNIVLLLSTFQEFFGLNNCSGSNRLDQAMQVTETLGMTHCCINPIIYAFV
GEKFRNYLLRFFRKYFASRFCKGCPVFQGEAPERVSSVYTRSTGEQEISVGL
GenBank ID Protein AAV97929.1
UniProtKB/Swiss-Prot ID Q2HJ17
UniProtKB/Swiss-Prot Entry Name CCR5_BOVIN
PDB IDs Not Available
GenBank Gene ID AY834252
GeneCard ID CCR5
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available