Showing Protein Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7 (BMDBP02208)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP02208 |
| Secondary Accession Numbers | None |
| Name | Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7 |
| Synonyms | Not Available |
| Gene Name | GNG7 |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in signal transducer activity |
| Specific Function | Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. Plays a role in the regulation of adenylyl cyclase signaling in certain regions of the brain. Plays a role in the formation or stabilzation of a G protein heterotrimer (G(olf) subunit alpha-beta-gamma-7) that is required for adenylyl cyclase activity in the striatum (By similarity). |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 7 |
| Locus | Not Available |
| SNPs | GNG7 |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 68 |
| Molecular Weight | 7552.0 |
| Theoretical pI | 8.77 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions | Not Available |
| Protein Sequence |
>Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7 MSATNNIAQARKLVEQLRIEAGIERIKVSKASSELMSYCEQHARNDPLLVGVPASENPFK DKKPCIIL |
| External Links | |
| GenBank ID Protein | AAI51398.1 |
| UniProtKB/Swiss-Prot ID | P30671 |
| UniProtKB/Swiss-Prot Entry Name | GBG7_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | M99393 |
| GeneCard ID | GNG7 |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |