You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Showing Protein 5-hydroxytryptamine 4 receptor (BMDBP02210)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP02210 |
| Secondary Accession Numbers | None |
| Name | 5-hydroxytryptamine 4 receptor |
| Synonyms | Not Available |
| Gene Name | 5htr4 |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in receptor activity |
| Specific Function | Not Available |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 7 |
| Locus | Not Available |
| SNPs | 5htr4 |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 73 |
| Molecular Weight | 8014.0 |
| Theoretical pI | 10.37 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions |
|
| Protein Sequence |
>5-hydroxytryptamine 4 receptor MDKLDANVSSKAGFRSVEKVVLLTFLSAVILMAILGNLLVMAAVCRDRQLRKIKTNYFIV SLAFADLLVSVLV |
| External Links | |
| GenBank ID Protein | CAD37211.1 |
| UniProtKB/Swiss-Prot ID | Q8MI07 |
| UniProtKB/Swiss-Prot Entry Name | Q8MI07_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | AJ491866 |
| GeneCard ID | 5htr4 |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |