You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP02210
Secondary Accession Numbers None
Name 5-hydroxytryptamine 4 receptor
Synonyms Not Available
Gene Name 5htr4
Protein Type Enzyme
Biological Properties
General Function Involved in receptor activity
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 7
Locus Not Available
SNPs 5htr4
Gene Sequence Not Available
Protein Properties
Number of Residues 73
Molecular Weight 8014.0
Theoretical pI 10.37
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • 20-44
  • 56-72
Protein Sequence
>5-hydroxytryptamine 4 receptor
MDKLDANVSSKAGFRSVEKVVLLTFLSAVILMAILGNLLVMAAVCRDRQLRKIKTNYFIV
SLAFADLLVSVLV
GenBank ID Protein CAD37211.1
UniProtKB/Swiss-Prot ID Q8MI07
UniProtKB/Swiss-Prot Entry Name Q8MI07_BOVIN
PDB IDs Not Available
GenBank Gene ID AJ491866
GeneCard ID 5htr4
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available