You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP02214
Secondary Accession Numbers None
Name 5-hydroxytryptamine 1F receptor
Synonyms Not Available
Gene Name 5htr1f
Protein Type Enzyme
Biological Properties
General Function Involved in G-protein coupled receptor activity
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 1
Locus Not Available
SNPs 5htr1f
Gene Sequence Not Available
Protein Properties
Number of Residues 82
Molecular Weight 9419.0
Theoretical pI 8.34
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • 14-35
  • 56-77
Protein Sequence
>5-hydroxytryptamine 1F receptor
VRESWIMGQVVCDIWLSVDITCCTCSILHLSAIALDRYRAITDAVEYARKRTPKHAGIMI
TIVWIISIFISMPPLFWRHQGT
GenBank ID Protein CAD37207.1
UniProtKB/Swiss-Prot ID Q8MI11
UniProtKB/Swiss-Prot Entry Name Q8MI11_BOVIN
PDB IDs Not Available
GenBank Gene ID AJ491862
GeneCard ID 5htr1f
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available