You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Showing Protein 5-hydroxytryptamine serotonin receptor 1B (BMDBP02221)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP02221 |
| Secondary Accession Numbers | None |
| Name | 5-hydroxytryptamine serotonin receptor 1B |
| Synonyms | Not Available |
| Gene Name | HTR1B |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in serotonin receptor activity |
| Specific Function | Not Available |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 9 |
| Locus | Not Available |
| SNPs | HTR1B |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 94 |
| Molecular Weight | 10524.0 |
| Theoretical pI | 7.35 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions |
|
| Protein Sequence |
>5-hydroxytryptamine serotonin receptor 1B AEEYIYQDFIALPWKVVVVLLLALFTLATTLSNSFVIATVYRTRKLHTPANYLIASLAVT DLLVSILVMPISTMYTVTGRWTLGQVVCDLWLSS |
| External Links | |
| GenBank ID Protein | ABI81479.1 |
| UniProtKB/Swiss-Prot ID | A1Y9P9 |
| UniProtKB/Swiss-Prot Entry Name | A1Y9P9_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | DQ862860 |
| GeneCard ID | HTR1B |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |