You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP02225
Secondary Accession Numbers None
Name 5-hydroxytryptamine serotonin receptor 1B
Synonyms Not Available
Gene Name HTR1B
Protein Type Enzyme
Biological Properties
General Function Involved in receptor activity
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 9
Locus Not Available
SNPs HTR1B
Gene Sequence Not Available
Protein Properties
Number of Residues 111
Molecular Weight 12690.0
Theoretical pI 9.69
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • 31-52
  • 72-92
Protein Sequence
>5-hydroxytryptamine serotonin receptor 1B
SILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSICISLPPFFWRQAKAEAM
SNCVVNTDHVLYTVYSTVGAFYFPTLLLIALYGRIYVEARSRILKQTPNRT
GenBank ID Protein ABI81481.1
UniProtKB/Swiss-Prot ID A1Y9Q1
UniProtKB/Swiss-Prot Entry Name A1Y9Q1_BOVIN
PDB IDs Not Available
GenBank Gene ID DQ862862
GeneCard ID HTR1B
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available