Showing Protein Sodium proton exchanger (BMDBP02273)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP02273 |
| Secondary Accession Numbers | None |
| Name | Sodium proton exchanger |
| Synonyms | Not Available |
| Gene Name | Not Available |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Inorganic ion transport and metabolism |
| Specific Function | Not Available |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 2 |
| Locus | Not Available |
| SNPs | Not Available |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 141 |
| Molecular Weight | 15971.0 |
| Theoretical pI | 10.15 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions |
|
| Protein Sequence |
>Sodium proton exchanger EANISHKSHTTIKYFLKMWSSVSETLIFIFLGVSTVAGSHHWNWTFVISTLLFCLIARVL GVLGLTWFINKFRIVKLTPKDQFIIAYGGLRGAIAFSLGYLLDKKHFPMCDLFLTAIITV IFFTVFVQGMTIRPLVDLLAP |
| External Links | |
| GenBank ID Protein | CAA10507.1 |
| UniProtKB/Swiss-Prot ID | O97738 |
| UniProtKB/Swiss-Prot Entry Name | O97738_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | AJ131763 |
| GeneCard ID | Not Available |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |