Showing Protein E3 ubiquitin-protein ligase (BMDBP02308)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP02308 |
| Secondary Accession Numbers | None |
| Name | E3 ubiquitin-protein ligase |
| Synonyms | Not Available |
| Gene Name | Not Available |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in protein binding |
| Specific Function | E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. |
| Pathways |
|
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 18 |
| Locus | Not Available |
| SNPs | Not Available |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 352 |
| Molecular Weight | 38156.0 |
| Theoretical pI | 8.5 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions | Not Available |
| Protein Sequence |
>Putative uncharacterized protein AKRRRRRRPGGSRGGRCGAHSRAAAAAQSVPSVLARGGGGGAARGGGGWRRRQSAFEPGP GSEARSPPTEMSRQTATALPTGTSKCAPSQRVPALTGTTASNNDLASLFECPVCFDYVLP PILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEITLP HTEKADHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDI NLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGH RRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC |
| External Links | |
| GenBank ID Protein | AAI49765.1 |
| UniProtKB/Swiss-Prot ID | A6QQC5 |
| UniProtKB/Swiss-Prot Entry Name | A6QQC5_BOVIN |
| PDB IDs | |
| GenBank Gene ID | BC149764 |
| GeneCard ID | Not Available |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |