Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP02451
Secondary Accession Numbers None
Name ABLIM1 protein
Synonyms Not Available
Gene Name ABLIM1
Protein Type Enzyme
Biological Properties
General Function Involved in actin binding
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 26
Locus Not Available
SNPs ABLIM1
Gene Sequence Not Available
Protein Properties
Number of Residues 515
Molecular Weight 58242.0
Theoretical pI 9.41
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>ABLIM1 protein
CLRRRTGFVSRFRGELAPVPEAGREPRSRGPRSGVYKPLGSVVGLKPRGIPCSEQPGTEV
EEKEPGLKAGDKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHPDCKQSTKTEEKLRPTR
TSSESIYSRPGSSIPGSPGHTIYAKVDNEILDYKDLAAIPKVKAIYDIERPDLITYEPFY
SSGYDDKQERQSLGESPRTLSPTPSAEGYQDGRDRMIHRSTSQGSINSPVYSRHSYTPTT
SRSPQHFHRPDQGINIYRKPPIYKQHAALAAQSKSSEDIIKFSKFPAAQAPDPSEIPKIE
TDHWPGPPSLAAVGADTRRRSSGREEEDEELLRRRQLQEEQLMKLNSGLGQLILKEEMEK
ERESRERASLAASRYDSPINSASHVLSSKTASLPGYGRNGLHRPVSTDFAQYNSYGDVSG
GARDYQTLPDGHMPGMRMDRGVSMPNMLEPKIFPYEMLMVTNRGRNKILRDVDRTRLERH
LAPEVFREIFGMSIQEFDKLPLWRRNDMKKKAKLF
GenBank ID Protein AAI50105.1
UniProtKB/Swiss-Prot ID A6QR39
UniProtKB/Swiss-Prot Entry Name A6QR39_BOVIN
PDB IDs Not Available
GenBank Gene ID BC150104
GeneCard ID ABLIM1
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available