You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP02547
Secondary Accession Numbers None
Name RpB2
Synonyms Not Available
Gene Name rpB2
Protein Type Enzyme
Biological Properties
General Function Transcription
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 6
Locus Not Available
SNPs rpB2
Gene Sequence Not Available
Protein Properties
Number of Residues 47
Molecular Weight 5508.0
Theoretical pI 9.84
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>RpB2
KISNLLSDYGYHLRGNEVLYNGFTGRKITSQIFIGPTYYQRLKHMVD
GenBank ID Protein ABX80205.1
UniProtKB/Swiss-Prot ID B2WTN5
UniProtKB/Swiss-Prot Entry Name B2WTN5_BOVIN
PDB IDs Not Available
GenBank Gene ID EF536005
GeneCard ID rpB2
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available