You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Showing Protein RpB2 (BMDBP02547)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP02547 |
| Secondary Accession Numbers | None |
| Name | RpB2 |
| Synonyms | Not Available |
| Gene Name | rpB2 |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Transcription |
| Specific Function | Not Available |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 6 |
| Locus | Not Available |
| SNPs | rpB2 |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 47 |
| Molecular Weight | 5508.0 |
| Theoretical pI | 9.84 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions | Not Available |
| Protein Sequence |
>RpB2 KISNLLSDYGYHLRGNEVLYNGFTGRKITSQIFIGPTYYQRLKHMVD |
| External Links | |
| GenBank ID Protein | ABX80205.1 |
| UniProtKB/Swiss-Prot ID | B2WTN5 |
| UniProtKB/Swiss-Prot Entry Name | B2WTN5_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | EF536005 |
| GeneCard ID | rpB2 |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |