Showing Protein Histidine triad nucleotide binding protein 1 (BMDBP02581)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP02581 |
| Secondary Accession Numbers | None |
| Name | Histidine triad nucleotide binding protein 1 |
| Synonyms | Not Available |
| Gene Name | HINT1 |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Nucleotide transport and metabolism |
| Specific Function | Not Available |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 7 |
| Locus | Not Available |
| SNPs | HINT1 |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 55 |
| Molecular Weight | 6000.0 |
| Theoretical pI | 7.52 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions | Not Available |
| Protein Sequence |
>Histidine triad nucleotide binding protein 1 QAPTHFLVIPKKYISQISAAEDDDESLLGHLMIVGKKCAADLGLKKGYRMVVNEG |
| External Links | |
| GenBank ID Protein | ABC55277.1 |
| UniProtKB/Swiss-Prot ID | A1XEA3 |
| UniProtKB/Swiss-Prot Entry Name | A1XEA3_BOVIN |
| PDB IDs | |
| GenBank Gene ID | DQ347568 |
| GeneCard ID | HINT1 |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |