Showing Protein Suppressor of cytokine signaling 3 (BMDBP02595)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP02595 |
| Secondary Accession Numbers | None |
| Name | Suppressor of cytokine signaling 3 |
| Synonyms | Not Available |
| Gene Name | SOCS3 |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in intracellular signaling cascade |
| Specific Function | SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. SOCS3 is involved in negative regulation of cytokines that signal through the JAK/STAT pathway. Inhibits cytokine signal transduction by binding to tyrosine kinase receptors including gp130, LIF, erythropoietin, insulin and leptin receptors. Inhibits JAK2 kinase activity. Suppresses fetal liver erythropoiesis. Regulates onset and maintenance of allergic responses mediated by T-helper type 2 cells. Regulates IL-6 signaling in vivo. Probable substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Seems to recognize IL6ST (By similarity). |
| Pathways |
|
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 19 |
| Locus | Not Available |
| SNPs | SOCS3 |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 229 |
| Molecular Weight | 25134.0 |
| Theoretical pI | 9.08 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions | Not Available |
| Protein Sequence |
>Suppressor of cytokine signaling 3 MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSTVTGGEANLLL SAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCV LKLVHHYMPAAGAPSFSQPPAEPSSSPSSEVPEQPPAQPLSGNPPRRAYYIYSGGEKIPL VLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL |
| External Links | |
| GenBank ID Protein | AAK07689.1 |
| UniProtKB/Swiss-Prot ID | Q9BEG9 |
| UniProtKB/Swiss-Prot Entry Name | SOCS3_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | AY026859 |
| GeneCard ID | SOCS3 |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |