You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP02595
Secondary Accession Numbers None
Name Suppressor of cytokine signaling 3
Synonyms Not Available
Gene Name SOCS3
Protein Type Enzyme
Biological Properties
General Function Involved in intracellular signaling cascade
Specific Function SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. SOCS3 is involved in negative regulation of cytokines that signal through the JAK/STAT pathway. Inhibits cytokine signal transduction by binding to tyrosine kinase receptors including gp130, LIF, erythropoietin, insulin and leptin receptors. Inhibits JAK2 kinase activity. Suppresses fetal liver erythropoiesis. Regulates onset and maintenance of allergic responses mediated by T-helper type 2 cells. Regulates IL-6 signaling in vivo. Probable substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Seems to recognize IL6ST (By similarity).
Pathways
  • Protein modification
  • Protein ubiquitination
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 19
Locus Not Available
SNPs SOCS3
Gene Sequence Not Available
Protein Properties
Number of Residues 229
Molecular Weight 25134.0
Theoretical pI 9.08
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>Suppressor of cytokine signaling 3
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSTVTGGEANLLL
SAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCV
LKLVHHYMPAAGAPSFSQPPAEPSSSPSSEVPEQPPAQPLSGNPPRRAYYIYSGGEKIPL
VLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
GenBank ID Protein AAK07689.1
UniProtKB/Swiss-Prot ID Q9BEG9
UniProtKB/Swiss-Prot Entry Name SOCS3_BOVIN
PDB IDs Not Available
GenBank Gene ID AY026859
GeneCard ID SOCS3
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available