You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP02597
Secondary Accession Numbers None
Name TYRO protein tyrosine kinase-binding protein
Synonyms Not Available
Gene Name TYROBP
Protein Type Enzyme
Biological Properties
General Function Not Available
Specific Function Adapter protein which non-covalently associates with activating receptors found on the surface of a variety of immune cells to mediate signaling and cell activation following ligand binding by the receptors (By similarity). TYROBP is tyrosine-phosphorylated in the ITAM domain following ligand binding by the associated receptors which leads to activation of additional tyrosine kinases and subsequent cell activation (By similarity). Also has an inhibitory role in some cells (By similarity). Non-covalently associates with activating receptors of the CD300 family to mediate cell activation (By similarity). Also mediates cell activation through association with activating receptors of the CD200R family (By similarity). Required for neutrophil activation mediated by integrin (By similarity). Required for the activation of myeloid cells mediated by the CLEC5A/MDL1 receptor (By similarity). Associates with natural killer (NK) cell receptors such as the KLRD1/KLRC2 heterodimer to mediate NK cell activation (By similarity). Associates with TREM1 to mediate activation of neutrophils and monocytes (By similarity). Associates with TREM2 on monocyte-derived dendritic cells to mediate up-regulation of chemokine receptor CCR7 and dendritic cell maturation and survival (By similarity). Association with TREM2 mediates cytokine-induced formation of multinucleated giant cells which are formed by the fusion of macrophages (By similarity). Stabilizes the TREM2 C-terminal fragment (TREM2-CTF) produced by TREM2 ectodomain shedding which suppresses the release of pro-inflammatory cytokines (By similarity). In microglia, required with TREM2 for phagocytosis of apoptotic neurons (By similarity). Required with ITGAM/CD11B in microglia to control production of microglial superoxide ions which promote the neuronal apoptosis that occurs during brain development (By similarity). Promotes proinflammatory responses in microglia following nerve injury which accelerates degeneration of injured neurons (By similarity). Positively regulates the expression of the IRAK3/IRAK-M kinase and IL10 production by liver dendritic cells and inhibits their T cell allosimulatory ability (By similarity). Negatively regulates B cell proliferation (By similarity). Required for CSF1-mediated osteoclast cytoskeletal organization (By similarity). Positively regulates multinucleation during osteoclast development (By similarity).
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 18
Locus Not Available
SNPs TYROBP
Gene Sequence
>327 bp
ATGGAGGGCCTTAGACCCTCCGACAGGCTCCTATCTCTCCTTCTGACTGTGGGTGGTCTC
AGCCTCGTCCTGGCCCAGAGTGAATGCAACTGCTCCTCGGTGAGCCCGGGCGTGCTGGCA
GGGATCGTGTTGGGGGACCTGATGCTGACCCTCCTCATCGCTCTGGCTGTGTACTACCTG
GGTCGGCTGGTCCCTCGGGGGCGAGGGGCTACGGAGGTGACCCGGAAACAGCACATCCCG
GAGACAGAGTCGCCTTATCAGGAGCTCCAAGGCCAGAGGACAGATGTCTACAGCGACCTC
AACACACAGAGGCCGTATTACAAATGA
Protein Properties
Number of Residues 108
Molecular Weight 11836.0
Theoretical pI 7.25
Pfam Domain Function Not Available
Signals
  • 1-25
Transmembrane Regions
  • 37-57
Protein Sequence
>TYRO protein tyrosine kinase-binding protein
MEGLRPSDRLLSLLLTVGGLSLVLAQSECNCSSVSPGVLAGIVLGDLMLTLLIALAVYYL
GRLVPRGRGATEVTRKQHIPETESPYQELQGQRTDVYSDLNTQRPYYK
GenBank ID Protein CAD11669.1
UniProtKB/Swiss-Prot ID Q95J79
UniProtKB/Swiss-Prot Entry Name TYOBP_BOVIN
PDB IDs Not Available
GenBank Gene ID AJ419227
GeneCard ID TYROBP
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available