Showing Protein Caveolin-2 (BMDBP02598)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP02598 |
| Secondary Accession Numbers | None |
| Name | Caveolin-2 |
| Synonyms | Not Available |
| Gene Name | CAV2 |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Not Available |
| Specific Function | May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Acts as an accessory protein in conjunction with CAV1 in targeting to lipid rafts and driving caveolae formation. Positive regulator of cellular mitogenesis of the MAPK signaling pathway. Required for the insulin-stimulated nuclear translocation and activation of MAPK1 and STAT3, and the subsequent regulation of cell cycle progression (By similarity). |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 4 |
| Locus | Not Available |
| SNPs | CAV2 |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 162 |
| Molecular Weight | 18160.0 |
| Theoretical pI | 5.46 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions | Not Available |
| Protein Sequence |
>Caveolin-2 MGLETEKADVQLFMDDDSYSRHSSVDYADPDKFVDPGSDRDPHRLNSHLKVGFEDVIAEP VSTHSFDKVWICSHALFEMSKYVIYKFLTVFLAIPLAFAAGILFATLSCLHIWIIMPFVK TCLMVLPSVQTIWKSVTDVVIAPLCTSIGRSFSSVSLQLSHD |
| External Links | |
| GenBank ID Protein | AAU05317.1 |
| UniProtKB/Swiss-Prot ID | Q66WT7 |
| UniProtKB/Swiss-Prot Entry Name | CAV2_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | AY699947 |
| GeneCard ID | CAV2 |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |