Showing Protein Fatty acid-binding protein, liver (BMDBP02601)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP02601 |
| Secondary Accession Numbers | None |
| Name | Fatty acid-binding protein, liver |
| Synonyms | Not Available |
| Gene Name | FABP1 |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in lipid binding |
| Specific Function | Plays a role in lipoprotein-mediated cholesterol uptake in hepatocytes. Binds cholesterol. Binds free fatty acids and their coenzyme A derivatives, bilirubin, and some other small molecules in the cytoplasm. May be involved in intracellular lipid transport. |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 11 |
| Locus | Not Available |
| SNPs | FABP1 |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 127 |
| Molecular Weight | 14227.0 |
| Theoretical pI | 8.46 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions | Not Available |
| Protein Sequence |
>Fatty acid-binding protein, liver MNFSGKYQVQTQENYEAFMKAVGMPDDIIQKGKDIKGVSEIVQNGKHFKFIITAGSKVIQ NEFTLGEECEMEFMTGEKIKAVVQQEGDNKLVTTFKGIKSVTEFNGDTVTSTMTKGDVVF KRVSKRI |
| External Links | |
| GenBank ID Protein | CAA60506.1 |
| UniProtKB/Swiss-Prot ID | P80425 |
| UniProtKB/Swiss-Prot Entry Name | FABPL_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | X86904 |
| GeneCard ID | FABP1 |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |