Showing Protein CD320 antigen (BMDBP02677)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP02677 |
| Secondary Accession Numbers | None |
| Name | CD320 antigen |
| Synonyms | Not Available |
| Gene Name | CD320 |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in growth factor activity |
| Specific Function | Receptor for transcobalamin saturated with cobalamin (TCbl). Plays an important role in cobalamin uptake. Plasma membrane protein that is expressed on follicular dendritic cells (FDC) and mediates interaction with germinal center B cells. Functions as costimulator to promote B cell responses to antigenic stimuli; promotes B cell differentiation and proliferation. Germinal center-B (GC-B) cells differentiate into memory B-cells and plasma cells (PC) through interaction with T-cells and follicular dendritic cells (FDC). CD320 augments the proliferation of PC precursors generated by IL-10. |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 7 |
| Locus | Not Available |
| SNPs | CD320 |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 255 |
| Molecular Weight | 26935.0 |
| Theoretical pI | 4.24 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions |
|
| Protein Sequence |
>CD320 antigen MNGWVARGLARRAAALGLGLRVLLCFGLCLEIAPTPIQTWSPTQAPGPSAGSCPPTNFQC RSDGRCLPLIWRCDVDQDCPDGSDEEECGTEVPNGSPSPCDIMDDCPDHNKNLLNCGPQS CPEGELCCPLDGVCIPSTWLCDGHRDCSDYSDELGCGTKTHEEGRTMSTGTPVTLENVTY LSNATVTAIEDWDSVQSGNRNVYGIIAAVAVLSISLAAGILFALSRLCAQGCLAPLGLLV SMKGSLQPEKKTSVL |
| External Links | |
| GenBank ID Protein | AAI49058.1 |
| UniProtKB/Swiss-Prot ID | A6QNY1 |
| UniProtKB/Swiss-Prot Entry Name | CD320_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | BC149057 |
| GeneCard ID | CD320 |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |