| Identification |
| BMDB Protein ID
| BMDBP02727 |
| Secondary Accession Numbers
| None |
| Name
| C-X-C chemokine receptor type 4 |
| Synonyms
|
Not Available
|
| Gene Name
| CXCR4 |
| Protein Type
| Enzyme |
| Biological Properties |
| General Function
| Involved in C-C chemokine receptor activity |
| Specific Function
| Receptor for the C-X-C chemokine CXCL12/SDF-1 that transduces a signal by increasing intracellular calcium ion levels and enhancing MAPK1/MAPK3 activation. Involved in the AKT signaling cascade (By similarity). Plays a role in regulation of cell migration, e.g. during wound healing. Acts as a receptor for extracellular ubiquitin; leading to enhanced intracellular calcium ions and reduced cellular cAMP levels. Binds bacterial lipopolysaccharide (LPS) et mediates LPS-induced inflammatory response, including TNF secretion by monocytes (By similarity). Involved in hematopoiesis and in cardiac ventricular septum formation. Also plays an essential role in vascularization of the gastrointestinal tract, probably by regulating vascular branching and/or remodeling processes in endothelial cells. Involved in cerebellar development. In the CNS, could mediate hippocampal-neuron survival (By similarity). |
| Pathways
|
Not Available
|
| Reactions
| Not Available |
| GO Classification
|
Not Available
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 2 |
| Locus
| Not Available |
| SNPs
| CXCR4 |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| 353 |
| Molecular Weight
| 39939.0 |
| Theoretical pI
| 8.3 |
| Pfam Domain Function
|
Not Available |
| Signals
|
|
|
Transmembrane Regions
|
- 40-64
- 79-100
- 112-131
- 156-175
- 197-217
- 243-262
- 284-303
|
| Protein Sequence
|
>C-X-C chemokine receptor type 4
MEGIRIFTSDNYTEDDLGSGDYDSMKEPCFREENAHFNRIFLPTVYSIIFLTGIVGNGLV
ILVMGYQKKLRSMTDKYRLHLSVADLLFVLTLPFWAVDAVANWYFGKFLCKAVHVIYTVN
LYSSVLILAFISLDRYLAIVHATNSQKPRKLLAEKVVYVGVWLPAVLLTIPDLIFADIKE
VDERYICDRFYPSDLWLVVFQFQHIVVGLLLPGIVILSCYCIIISKLSHSKGYQKRKALK
TTVILILTFFACWLPYYIGISIDSFILLEIIQQGCEFESTVHKWISITEALAFFHCCLNP
ILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS
|
| External Links |
| GenBank ID Protein
| AAK94452.1 |
| UniProtKB/Swiss-Prot ID
| P25930 |
| UniProtKB/Swiss-Prot Entry Name
| CXCR4_BOVIN |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| M86739 |
| GeneCard ID
| CXCR4 |
| GenAtlas ID
| Not Available |
| HGNC ID
| Not Available |
| References |
| General References
| Not Available |