Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00069
Secondary Accession Numbers None
Name Nitric oxide synthase, inducible
Synonyms Not Available
Gene Name NOS2
Protein Type Enzyme
Biological Properties
General Function Inorganic ion transport and metabolism
Specific Function Produces nitric oxide (NO) which is a messenger molecule with diverse functions throughout the body. In macrophages, NO mediates tumoricidal and bactericidal actions. Also has nitrosylase activity and mediates cysteine S-nitrosylation of cytoplasmic target proteins such PTGS2/COX2. As component of the iNOS-S100A8/9 transnitrosylase complex involved in the selective inflammatory stimulus-dependent S-nitrosylation of GAPDH implicated in regulation of the GAIT complex activity and probably multiple targets including ANXA5, EZR, MSN and VIM. Involved in inflammation, enhances the synthesis of proinflammatory mediators such as IL6 and IL8.
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 19
Locus Not Available
SNPs NOS2
Gene Sequence
>3471 bp
ATGGCCTGTCCCTGGCAGTTTCTGTTCAAAATCAAATCCCAAAAGGTGGACTTGGCTACG
GAACTGGACATCAACAACAATGTGGGAAAATTCTACCAGCCCCCGTCCAGTCCAGTGACA
CAGGATGACCCCAAACGTCACAGCCCGGGCAAGCACGGGAATGAGTCTCCCCAGCCCCTC
ACGGGGACAGTAAAGACGTCTCCAGAATCCCTGAGCAAGCTGGACGCGCCCCCGTCAGCC
TGTCCACGGCATGTGAGGATCAAAAACTGGGGCAGCGGAGTGACTTTCCAAGACACGCTT
CACCAGAAGGCCAAAGGGGATCTCTCTTGCAAGTCCAAGTCTTGCCTGGCATCCATCATG
AACCCCAAAAGTTTGACCATAGGACCCCGGGACAAGCCAACCCCCCCAGACGAGCTTCTA
CCTCAAGCTATCGAATTTGTCAACCAGTATTACGGCTCCTTCAAAGAGGCAAAAATAGAG
GAACATCTGGCCAGGGTGGAAGCAGTAACAAAGGAGATAGAAACAACAGGAACCTACCAG
CTGACGGGAGATGAGCTCATCTTCGCCACCAAGCAGGCCTGGCGCAACGCCCCCCGCTGC
ATCGGAAGGATCCAGTGGTCGAACCTGCAGGTCTTTGACGCCCGGAGCTGTTCCACGGCC
CAGGAAATGTTCGAACACATCTGCAGACACGTGCGTTATGCCACCAACAACGGCAACATC
AGGTCGGCCATCACTGTGTTCCCCCAGCGGAGCGATGGGAAGCATGACTTCCGGGTCTGG
AACGCCCAGCTCATCCGCTATGCCGGCTACCAGATGCCAGATGGCAGCATCAGAGGGGAC
CCCGCCAACGTGGAGTTCACACAGCTGTGCATCGACCTGGGCTGGAAGCCCAAGTACGGC
CGCTTCGACGTGTTGCCTCTAGTCCTGCAGGCTGACGGCCGTGACCCAGAGCTCTTCGAA
ATCCCCCCTGACCTTGTTCTCGAGGTGCCCATGGAACATCCCAGGTACGAATGGTTCCGG
GAGCTGGAGCTCAAGTGGTACGCCCTGCCAGCCGTGGCCAACATGCTGCTTGAGGTGGGC
GGCCTCGAGTTCCCAGGGTGCCCCTTCAACGGGTGGTACATGGGCACAGAAGTTGGAGTC
CGGGACTTCTGCGACGCCCAGCGATACAACATCCTGGAGGAAGTGGGCAGAAGGATGGGC
CTGGAAACGCACAAGGTGGCCTCACTCTGGAAGGACCGGGCTGTCGTTGAGATCAACGTC
GCTGTGCTCCACAGTTTCCAGAAGCAGAACGTGACCATCATGGACCACCACTCCGCTGCA
GAGTCCTTCATGAAGTACATGCAGAATGAGTACCGCTCCCGAGGGGGCTGCCCAGCTGAC
TGGATTTGGCTGGTCCCCCCGATCTCTGGAAGCATCACCCCCGTGTTCCACCAGGAGATG
TTAAATTACGTCCTGTCCCCTTTCTACTACTACCAGGTGGAGCCCTGGAAAACCCACGTC
TGGCAGGACGAGAGGCGGAGACCCCAGAGAAGAGAAATTCGATTCAAAGTCTTGGTCAAA
GCCGTGTTCTTCGCCTCGGTGCTGATGCATAAGGCCATGGCATCCCGGGTCAGAGCCACG
ATCCTCTTTGCAACAGAGACGGGGAGATCGGAAACGCTGGCCCAGGACCTGGGGGCTTTG
TTCAGCTGTGCCTTCAACCCCAAGGTTCTCTGCATGGATCAGTACCAGCTGAGCCATCTG
GAGGAGGARCAGCTGCTGCTGGTGGTGACCAGCACTTTTGGCAACGGAGACTCCCCTGGC
AACGGAGAGAAACTGAAGAAGTCCCTCTTGATGCTGAAAGAACTCACCAACACGTTCCGG
TACGCCGTGTTTGGCCTTGGCTCCAGCATGTACCCTCAGTTCTGCGCTTTTGCTCATGAC
ATTGACCAGAAGTTGTCCCAGCTGGGGGCTTCTCAGCTTGCCCCAACCGGGGAAGGGGAC
GAACTCAGCGGGCAGGAGGAGGCCTTTCGCAGCTGGGCCGTGCAAACCTTCAAGGCAGCC
TGTGAGACATTCGATGTCAGCGGCAAGCACCACATTGAGATCCCCAAGCTCTACACTTCC
AATGTGACCTGGGACCCGCAGCACTACAGGCTCGTGCAGGACTCAGAGCCTCTGGACCTC
AACAAAGCCCTGAGCAGTATGCACGCCAAGCATGTGTTCACCATGAGGCTCAAATCGCAG
CAGAATCTGCAGAGTCCGAAATCCAGCCGCACCACCCTCCTGGTGGAACTCTCCTGTGAG
GGCAGCCAAGCTCCAAGCTACCTGCCGGGAGAGCACCTCGGAGTTTTCCCATGCAACCAG
CCGGCCCTGGTTCAAGGCATCCTTGAGCGAGTGGTGGATGGCCCTGCCCCGCACCAGCCT
GTGCGCCTGGAGACCCTCTGTGAGAATGGCAGCTATTGGGTCAAGGATAAGCGGCTGCCA
CCTTGCTCACTCAGCCAGGCTCTCACCTATTTCCTGGACATCACCACCCCGCCAACCCAG
CTGCTGCTCCGAAAGCTGGCCCAGCTGGCCACAGAAGAGGCTGAGAAGCAGAGGCTGGAG
ACCCTATGCCAGCCCTCAGATTACAACAAGTGGAAGTTCACCAACAGCCCCACATTTCTG
GAGGTGCTGGAGGAGTTCCCGTCCCTGCGGGTGTCTGCCAGCTTCCTGCTCTCCCAGCTC
CCTATTCTGAAGCCCCGGTACTACTCCATCAGCTCCTCCAGGGACCTCACACCCACGGAG
ATCCACCTCACTGTGGCCGTGCTCACGTACCGCACCCGAGATGGCCAAGGTCCCCTGCAC
CATGGTGTCTGCAGCACGTGGCTCAGCAGCTTGAAGCCCCAAGACCCGGTGCCCTGCTTT
GTGCGAAGTGCCAGYGGCTTCCAGCTTCCCGAGGACCGCTCCCGTCCTTGCATCCTCATT
GGGCCCGGCACGGGCATCGCCCCCTTCCGCAGTTTCTGGCAGCAGCGGCTCCATGAGGCT
GAGCACAAAGGGCTCCAGGGCGGCCGCATGACCCTGGTTTTCGGGTGCCGCCGCCCAGAA
GAGGACCACCTCTACTGGGAGGAGATGCTGGAGATGGCCCGCAAGGGGGTGCTGCACGAG
GTGCACACCGCCTATTCCCGCCTGCCTGACCAGCCCAAGGTCTATGTTCAAGACATCCTG
CGGCAGCGGCTGGCGGGCGAGGTGCTTCGCGTGCTCCATGAGGAGCAAGGTCACCTCTAT
GTCTGTGGGGATGTGCGCATGGCCCGGGACGTGGCCCGCACCCTGAAGCAGCTGATGGCT
ACTGCGCTGAGCCTGAACGAGGAACAGGTGGAGGACTATTTCTTCCAGCTCAAGAACCAG
AAGCGCTATCATGAAGACATCTTTGGTGCTGTATTTCCCTATGAGGTGAAAAAGGATGGG
GCAGCAGGGCTGCCCAGCAATCCCAGAGCTCCAGGCGCCCACAGAAGTTAA
Protein Properties
Number of Residues 1156
Molecular Weight 131208.0
Theoretical pI 7.42
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>Nitric oxide synthase, inducible
MACPWQFLFKIKSQKVDLATELDINNNVGKFYQPPSSPVTQDDPKRHSPGKHGNESPQPL
TGTVKTSPESLSKLDAPPSACPRHVRIKNWGSGVTFQDTLHQKAKGDLSCKSKSCLASIM
NPKSLTIGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQ
LTGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARSCSTAQEMFEHICRHVRYATNNGNI
RSAITVFPQRSDGKHDFRVWNAQLIRYAGYQMPDGSIRGDPANVEFTQLCIDLGWKPKYG
RFDVLPLVLQADGRDPELFEIPPDLVLEVPMEHPRYEWFRELELKWYALPAVANMLLEVG
GLEFPGCPFNGWYMGTEVGVRDFCDAQRYNILEEVGRRMGLETHKVASLWKDRAVVEINV
AVLHSFQKQNVTIMDHHSAAESFMKYMQNEYRSRGGCPADWIWLVPPISGSITPVFHQEM
LNYVLSPFYYYQVEPWKTHVWQDERRRPQRREIRFKVLVKAVFFASVLMHKAMASRVRAT
ILFATETGRSETLAQDLGALFSCAFNPKVLCMDQYQLSHLEEEQLLLVVTSTFGNGDSPG
NGEKLKKSLLMLKELTNTFRYAVFGLGSSMYPQFCAFAHDIDQKLSQLGASQLAPTGEGD
ELSGQEEAFRSWAVQTFKAACETFDVSGKHHIEIPKLYTSNVTWDPQHYRLVQDSEPLDL
NKALSSMHAKHVFTMRLKSQQNLQSPKSSRTTLLVELSCEGSQAPSYLPGEHLGVFPCNQ
PALVQGILERVVDGPAPHQPVRLETLCENGSYWVKDKRLPPCSLSQALTYFLDITTPPTQ
LLLRKLAQLATEEAEKQRLETLCQPSDYNKWKFTNSPTFLEVLEEFPSLRVSASFLLSQL
PILKPRYYSISSSRDLTPTEIHLTVAVLTYRTRDGQGPLHHGVCSTWLSSLKPQDPVPCF
VRSASGFQLPEDRSRPCILIGPGTGIAPFRSFWQQRLHEAEHKGLQGGRMTLVFGCRRPE
EDHLYWEEMLEMARKGVLHEVHTAYSRLPDQPKVYVQDILRQRLAGEVLRVLHEEQGHLY
VCGDVRMARDVARTLKQLMATALSLNEEQVEDYFFQLKNQKRYHEDIFGAVFPYEVKKDG
AAGLPSNPRAPGAHRS
GenBank ID Protein ABG74910.1
UniProtKB/Swiss-Prot ID Q27995
UniProtKB/Swiss-Prot Entry Name NOS2_BOVIN
PDB IDs
GenBank Gene ID DQ676956
GeneCard ID NOS2
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available