You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00078
Secondary Accession Numbers None
Name CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase, mitochondrial
Synonyms Not Available
Gene Name PGS1
Protein Type Enzyme
Biological Properties
General Function Lipid transport and metabolism
Specific Function Functions in the biosynthesis of the anionic phospholipids phosphatidylglycerol and cardiolipin.
Pathways
  • Cardiolipin Biosynthesis
  • Cardiolipin Biosynthesis CL(16:0/16:0/16:0/16:0)
  • Cardiolipin Biosynthesis CL(16:0/16:0/16:0/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/16:0/18:0)
  • Cardiolipin Biosynthesis CL(16:0/16:0/16:0/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/16:0/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/16:0/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/16:0/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/16:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/16:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/16:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/16:0/16:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/16:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/16:0/16:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/16:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/16:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/16:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:0/16:0)
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:0/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:0/18:0)
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:0/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:0/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:0/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:0/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:1(11Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:1(11Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:1(11Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:1(11Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:2(9Z,12Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/16:0/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/16:0/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/16:0/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/16:0/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/16:0/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/16:0/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/16:0/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/16:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/16:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/16:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/16:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/16:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/16:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/18:0/16:0)
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/18:0/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/18:0/18:0)
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/18:1(11Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/18:1(11Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/16:0/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/16:0/18:0)
  • Cardiolipin Biosynthesis CL(16:0/18:0/16:0/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/16:0/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/16:0/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/16:0/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/16:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/16:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/16:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:0/16:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/16:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/18:0/18:0/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:0/18:0/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/18:0/18:0)
  • Cardiolipin Biosynthesis CL(16:0/18:0/18:0/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/18:0/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/18:0/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/18:0/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/18:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/18:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/18:1(11Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:0/18:1(11Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/18:0/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:0/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/18:0/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:0/18:2(9Z,12Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/18:0/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:0/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/18:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/16:0/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/16:0/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/16:0/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/16:0/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/16:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/16:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/16:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/16:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:0/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:0/18:0)
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:0/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:0/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:1(11Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:1(11Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:1(11Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:1(11Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/16:0/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/16:0/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/16:0/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/16:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/16:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/16:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/16:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:0/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:0/18:0)
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:0/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:0/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:1(11Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:1(11Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:1(11Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:1(11Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/16:0/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/16:0/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/16:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/16:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/16:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/18:0/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/18:0/18:0)
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/18:0/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/18:1(11Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/18:1(11Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/18:2(9Z,12Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/16:0/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/18:0/16:0)
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/18:0/18:0)
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/18:0/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:0/16:0)
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:0/18:0)
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:0/16:0)
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:0/18:0)
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0/16:0)
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0/18:0)
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/16:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/16:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/16:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/16:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/16:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/16:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/16:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/18:1(11Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/18:1(11Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/16:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/16:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/16:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/16:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:1(11Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:1(11Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:1(11Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:1(11Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:2(9Z,12Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/16:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/16:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/16:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/16:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/16:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/16:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/18:1(11Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/18:1(11Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/18:2(9Z,12Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/16:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/16:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/16:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/18:1(11Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/18:1(11Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/18:1(11Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/18:1(11Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/16:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/16:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/18:1(11Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/18:1(11Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/18:1(11Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/18:1(11Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/16:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/18:1(11Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/18:1(11Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/16:0/16:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/16:0/16:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/16:0/16:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/16:0/18:0/16:0)
  • Cardiolipin Biosynthesis CL(18:0/16:0/18:0/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/16:0/18:0/18:0)
  • Cardiolipin Biosynthesis CL(18:0/16:0/18:0/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/16:0/18:0/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/16:0/18:0/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/16:0/18:0/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/16:0/18:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/16:0/18:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/16:0/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/16:0/18:1(11Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/16:0/18:1(11Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/16:0/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/16:0/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/16:0/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/16:0/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/16:0/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/16:0/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/16:0/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/16:0/18:2(9Z,12Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/16:0/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/16:0/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/16:0/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/16:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/16:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/16:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/16:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/16:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/16:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/16:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/18:0/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/18:0/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/18:0/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/18:0/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/18:0/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/18:1(11Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/18:1(11Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/18:2(9Z,12Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/16:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/18:0/16:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/16:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:0/16:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/16:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/16:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/16:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:0/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:0/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:0/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:0/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:0/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:0/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:1(11Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:1(11Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:1(11Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:1(11Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:2(9Z,12Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/18:0/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:0/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/16:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/16:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/16:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/16:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:0/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:0/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:0/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:0/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:1(11Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:1(11Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:1(11Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:1(11Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:2(9Z,12Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/16:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/16:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/16:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/16:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:0/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:0/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:0/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:1(11Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:1(11Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:1(11Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:1(11Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:2(9Z,12Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/16:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/16:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/16:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/18:0/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/18:0/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/18:1(11Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/18:1(11Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/18:2(9Z,12Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/18:0/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/18:1(11Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/18:1(11Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/18:1(11Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/18:1(11Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/18:1(11Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/18:1(11Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/18:1(11Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/18:1(11Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/18:1(11Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/18:2(9Z,12Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/18:1(11Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/18:2(9Z,12Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/18:1(11Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/18:2(9Z,12Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/18:1(11Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/18:1(9Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/18:2(9Z,12Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/18:2(9Z,12Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/18:2(9Z,12Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/18:1(9Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:0/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:0/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:0/18:2(9Z,12Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:0/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:0/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:0/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:0/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:0/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:0/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:0/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:0/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:0/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:1(9Z)/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:1(9Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:1(9Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:1(9Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:1(9Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:1(9Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:1(9Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:0/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:0/18:2(9Z,12Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:0/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:0/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:0/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:0/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:0/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:0/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:0/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:0/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:0/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/18:1(11Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/18:1(11Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/18:1(11Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/18:1(11Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(11Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(11Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(9Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:3(6Z,9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:3(9Z,12Z,15Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/20:4(8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/20:4(8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:1(11Z)/18:2(9Z,12Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(20:1(11Z)/18:2(9Z,12Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(20:1(11Z)/18:2(9Z,12Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(20:1(11Z)/18:2(9Z,12Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(20:1(11Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(20:1(11Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(20:2(11Z,14Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(20:2(11Z,14Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(20:2(11Z,14Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:3(5Z,8Z,11Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:3(5Z,8Z,11Z)/20:3(5Z,8Z,11Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:3(5Z,8Z,11Z)/20:3(8Z,11Z,14Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:3(8Z,11Z,14Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:3(8Z,11Z,14Z)/20:3(5Z,8Z,11Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:3(8Z,11Z,14Z)/20:3(8Z,11Z,14Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:0/20:4(5Z,8Z,11Z,14Z)/16:0)
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:0/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:0/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:0/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:0/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:0/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:0/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:0/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:0/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:0/20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:0/20:4(5Z,8Z,11Z,14Z)/18:0)
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:0/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:0/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:0/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:0/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:0/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:0/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:0/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:1(11Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:2(11Z,14Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:3(5Z,8Z,11Z)/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:3(5Z,8Z,11Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:3(8Z,11Z,14Z)/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:3(8Z,11Z,14Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z)/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(20:4(8Z,11Z,14Z,17Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(8Z,11Z,14Z,17Z)/20:1(11Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(8Z,11Z,14Z,17Z)/20:2(11Z,14Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(8Z,11Z,14Z,17Z)/20:3(5Z,8Z,11Z)/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(8Z,11Z,14Z,17Z)/20:3(5Z,8Z,11Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(8Z,11Z,14Z,17Z)/20:3(8Z,11Z,14Z)/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(8Z,11Z,14Z,17Z)/20:3(8Z,11Z,14Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(20:4(8Z,11Z,14Z,17Z)/20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(20:4(8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(20:4(8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(20:4(8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z)/18:2(9Z,12Z)/16:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/16:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:0/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:1(11Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:1(11Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:1(11Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:1(9Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:1(9Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:1(9Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/16:1(9Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:2(11Z,14Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:3(5Z,8Z,11Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:3(5Z,8Z,11Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:3(5Z,8Z,11Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:3(8Z,11Z,14Z)/18:2(9Z,12Z)/18:1(11Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:3(8Z,11Z,14Z)/18:2(9Z,12Z)/18:1(9Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:3(8Z,11Z,14Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/18:3(6Z,9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/18:3(9Z,12Z,15Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(8Z,11Z,14Z,17Z)/18:3(6Z,9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(8Z,11Z,14Z,17Z)/18:3(9Z,12Z,15Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z)/18:2(9Z,12Z))
  • Cardiolipin Biosynthesis CL(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylglycerol biosynthesis
  • Phosphatidylglycerol from CDP-diacylglycerol: step 1/2
  • Phospholipid Biosynthesis
  • Phospholipid metabolism
Reactions
Glycerol 3-phosphate + a CDP-diacylglycerol → an L-1-phosphatidylglycerol-phosphate + Cytidine monophosphate details
CDP-DG(16:0/18:1(11Z)) + Glycerol 3-phosphate → PGP(16:0/18:1(11Z)) + Cytidine monophosphate details
CDP-DG(18:1(9Z)/18:1(9Z)) + Glycerol 3-phosphate → PGP(18:1(9Z)/18:1(9Z)) + Cytidine monophosphate details
CDP-DG(18:2(9Z,12Z)/18:2(9Z,12Z)) + Glycerol 3-phosphate → PGP(18:2(9Z,12Z)/18:2(9Z,12Z)) + Cytidine monophosphate details
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 19
Locus Not Available
SNPs PGS1
Gene Sequence Not Available
Protein Properties
Number of Residues 556
Molecular Weight 62732.0
Theoretical pI 9.1
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase, mitochondrial
MAAAAAAAAGPVFWRRLLGLLPGRPGLAALLGRLSDRLGRNPDRRRRRSPWLLLAPLLSP
AVPVVTSPPCCLCAEGVHRFQWIRNLVPEFGVSSSHVRVLSSPAEFFELMKGQIKVAKRR
VVMASLYLGIGPLEQELVDCLESTLEKSLQAKFPSGLRVSILLDFTRGSRGRKNSRTMLL
PLLQRFPEQVRVSLFHTPNLRGLLRLLIPERFNETIGLQHIKVYLFDNNVILSGANLSDS
YFTNRQDRYVFLQDCPEIADFFTELVDAVGDVSLQLQGDDTVQMVEGMVHPYKGDRAAYC
RAANKRVMDVINSARMRQQMLHAQTFHSDPLLTQEDAAAAGDRRPAPDTWIYPLIQMKPF
EIQIDEIVTETLLTEAERGAKVYLTTGYFNLTQAYMDLVLGTRAEYQILLASPEVNGFFG
AKGVAGAIPAAYVHIERQFYSEVCSLGQQERVQLQEYWRRDWTFHAKGLWLYLAGSSLPC
LTLIGSPNFGYRSVHRDLEAQIAIVTESRALQQQLHQEQEQLYRRAGVVSSATFEQPSRQ
VKLWVKMVTPLIKNFF
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q2KJ28
UniProtKB/Swiss-Prot Entry Name PGPS1_BOVIN
PDB IDs Not Available
GenBank Gene ID BC105551
GeneCard ID PGS1
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available