Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00362
Secondary Accession Numbers None
Name Citrate synthase, mitochondrial
Synonyms Not Available
Gene Name CS
Protein Type Enzyme
Biological Properties
General Function Energy production and conversion
Specific Function Not Available
Pathways
  • Carbohydrate metabolism
  • Citric Acid Cycle
  • Isocitrate from oxaloacetate: step 1/2
  • LPS and Citrate Signaling and Inflammation
  • Transfer of Acetyl Groups into Mitochondria
  • Tricarboxylic acid cycle
  • Warburg Effect
Reactions
Acetyl-CoA + Water + Oxalacetic acid → Citric acid + Coenzyme A details
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 5
Locus 5p
SNPs CS
Gene Sequence
>1401 bp
ATGGCTTTACTCACTGCGGCCGCCCGGCTATTCGGAGCTAAGAATGCATCCTGTCTTGTT
CTTGCTGCCAGGCATGCCAGTGCTTCTTCCACGAATTTGAAAGACATATTGGCTGATCTG
ATACCTAAGGAGCAGACCAGAGTGAAGGCCTTCAGGCAGCAACATGGCAAGACGGTGGTG
GGCCAGATCACTGTGGACATGATGTATGGTGGCATGCGAGGCATGAAGGGATTGGTATAT
GAAACATCAGTTCTTGATCCTGATGAGGGCATCCGTTTTAGAGGCTACAGCATCCCTGAA
TGCCAGAAACTGCTGCCAAAGGCTAAAGGGGGCGAAGAACCCTTGCCAGAGGGCTTATTT
TGGCTGCTGGTAACTGGACAAATCCCAACAGAGGAACAGGTATCTTGGCTCTCACAGGAG
TGGGCAAAGAGGGCAGCTCTGCCTTCCCACGTGGTCACCATGCTGGACAACTTTCCCACT
AATCTACACCCCATGTCTCAGCTCAGTGCAGCTGTTACAGCTCTCAACAGTGAAAGTACC
TTTGCCCGAGCATATTCAGAGGGTATCAACCGAACCAAGTACTGGGAGTTGATTTATGAA
GACTCTATGGATCTGATCGCAAAGCTTCCTTGTGTTGCAGCAAAGATCTACCGGAACCTG
TACCGAGAGGGCAGCAGTATTGGGGCCATTGACCCTAAGCTGGACTGGTCCCACAATTTC
ACCAACATGTTAGGCTATACTGACGCTCAGTTCACAGAGCTCATGCGCTTGTACCTCACC
ATCCACAGTGACCATGAAGGTGGCAACGTAAGTGCCCACACCAGCCACTTGGTGGGCAGT
GCCCTTTCAGACCCCTATTTGTCCTTTGCAGCAGCCATGAATGGGCTGGCAGGGCCCCTG
CATGGACTGGCAAATCAGGAAGTGCTTGTTTGGCTGACACAACTTCAGAAGGAAGTTGGC
AAAGATGTGTCAGATGAGAAGTTACGAGACTACATCTGGAACACACTCAACTCAGGACGG
GTTGTCCCGGGCTATGGCCATGCAGTACTAAGGAAGACTGATCCACGATATACCTGTCAA
CGAGAGTTTGCTCTGAAACACCTGCCTCAGGACCCCATGTTTAAGCTGGTTGCTCAGCTG
TACAAGATTGTGCCCAATATCCTCCTAGAGCAGGGCAAGGCAAAGAATCCGTGGCCCAAT
GTAGATGCTCACAGCGGGGTGCTGCTCCAGTACTACGGCATGACGGAGATGAATTACTAC
ACAGTCCTGTTTGGGGTATCACGGGCACTAGGTGTATTAGCACAGCTCATTTGGAGCCGA
GCCCTAGGCTTCCCTCTAGAAAGACCCAAGTCCATGAGCACAGATGGTCTGATGAAGTTT
GTGGACTCTAAGTCAGGGTGA
Protein Properties
Number of Residues 466
Molecular Weight 51773.0
Theoretical pI 8.29
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • 21-42
  • 54-73
  • 94-110
  • 116-133
  • 145-167
  • 193-216
  • 223-244
  • 256-277
  • 284-303
  • 309-330
  • 351-369
  • 389-414
Protein Sequence
>Citrate synthase, mitochondrial
MALLTAAARLFGAKNASCLVLAARHASASSTNLKDILADLIPKEQTRVKAFRQQHGKTVV
GQITVDMMYGGMRGMKGLVYETSVLDPDEGIRFRGYSIPECQKLLPKAKGGEEPLPEGLF
WLLVTGQIPTEEQVSWLSQEWAKRAALPSHVVTMLDNFPTNLHPMSQLSAAVTALNSEST
FARAYSEGINRTKYWELIYEDSMDLIAKLPCVAAKIYRNLYREGSSIGAIDPKLDWSHNF
TNMLGYTDAQFTELMRLYLTIHSDHEGGNVSAHTSHLVGSALSDPYLSFAAAMNGLAGPL
HGLANQEVLVWLTQLQKEVGKDVSDEKLRDYIWNTLNSGRVVPGYGHAVLRKTDPRYTCQ
REFALKHLPQDPMFKLVAQLYKIVPNILLEQGKAKNPWPNVDAHSGVLLQYYGMTEMNYY
TVLFGVSRALGVLAQLIWSRALGFPLERPKSMSTDGLMKFVDSKSG
GenBank ID Protein AAI14139.1
UniProtKB/Swiss-Prot ID Q29RK1
UniProtKB/Swiss-Prot Entry Name CISY_BOVIN
PDB IDs
GenBank Gene ID BC114138
GeneCard ID CS
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available