Showing Protein Alpha-enolase (BMDBP00464)
| Identification | |||
|---|---|---|---|
| BMDB Protein ID | BMDBP00464 | ||
| Secondary Accession Numbers |
|
||
| Name | Alpha-enolase | ||
| Synonyms | Not Available | ||
| Gene Name | ENO1 | ||
| Protein Type | Enzyme | ||
| Biological Properties | |||
| General Function | Carbohydrate transport and metabolism | ||
| Specific Function | Glycolytic enzyme the catalyzes the conversion of 2-phosphoglycerate to phosphoenolpyruvate (By similarity). In addition to glycolysis, involved in various processes such as growth control, hypoxia tolerance and allergic responses (PubMed:7499243). May also function in the intravascular and pericellular fibrinolytic system due to its ability to serve as a receptor and activator of plasminogen on the cell surface of several cell-types such as leukocytes and neurons (By similarity). Stimulates immunoglobulin production (By similarity). | ||
| Pathways |
|
||
| Reactions |
|
||
| GO Classification | Not Available | ||
| Cellular Location | Not Available | ||
| Gene Properties | |||
| Chromosome Location | 16 | ||
| Locus | Not Available | ||
| SNPs | ENO1 | ||
| Gene Sequence | Not Available | ||
| Protein Properties | |||
| Number of Residues | 434 | ||
| Molecular Weight | 47326.0 | ||
| Theoretical pI | 6.79 | ||
| Pfam Domain Function | Not Available | ||
| Signals |
|
||
| Transmembrane Regions | Not Available | ||
| Protein Sequence |
>Alpha-enolase MSILKVHAREIFDSRGNPTVEVDLFTAKGLFRAAVPSGASTGIYEALELRDNDKTRYMGK GVSKAVEHINKTIAPALVSKKLNVVEQEKIDKLMIEMDGTENKSKFGANAILGVSLAVCK AGAVEKGVPLYRHIADLAGNAEVILPVPAFNVINGGSHAGNKLAMQEFMILPVGAENFRE AMRIGAEVYHNLKNVIKEKYGKDATNVGDEGGFAPNILENKEALELLKNAIGKAGYSDKV VIGMDVAASEFYRSGKYDLDFKSPDDPSRYITPDELANLYKSFIRDYPVVSIEDPFDQDD WEAWQKFTASAGIQVVGDDLTVTNPKRIAKAVSEKSCNCLLLKVNQIGSVTESLQACKLA QSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTVAPCRSERLAKYNQILRIEEELGSK AKFAGRSFRNPLAK |
||
| External Links | |||
| GenBank ID Protein | AAD33073.1 | ||
| UniProtKB/Swiss-Prot ID | Q9XSJ4 | ||
| UniProtKB/Swiss-Prot Entry Name | ENOA_BOVIN | ||
| PDB IDs | Not Available | ||
| GenBank Gene ID | AF149256 | ||
| GeneCard ID | ENO1 | ||
| GenAtlas ID | Not Available | ||
| HGNC ID | Not Available | ||
| References | |||
| General References | Not Available | ||