Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00507
Secondary Accession Numbers None
Name Nucleoside diphosphate kinase B
Synonyms Not Available
Gene Name NME2
Protein Type Enzyme
Biological Properties
General Function Nucleotide transport and metabolism
Specific Function Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate (By similarity). Negatively regulates Rho activity by interacting with AKAP13/LBC. Acts as a transcriptional activator of the MYC gene; binds DNA non-specifically. Binds to both single-stranded guanine- and cytosine-rich strands within the nuclease hypersensitive element (NHE) III(1) region of the MYC gene promoter. Does not bind to duplex NHE III(1). Has G-quadruplex (G4) DNA-binding activity, which is independent of its nucleotide-binding and kinase activity. Binds both folded and unfolded G4 with similar low nanomolar affinities. Stabilizes folded G4s regardless of whether they are prefolded or not (By similarity). Exhibits histidine protein kinase activity (PubMed:12486123).
Pathways
  • Lactose Synthesis
Reactions
Adenosine triphosphate + Uridine 5'-diphosphate → ADP + Uridine triphosphate details
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 19
Locus Not Available
SNPs NME2
Gene Sequence
>459 bp
ATGGCCCACGCGGAGCGCACCTTTATTGCTATCAAGCCGGACGGCGTGCAGCGCGGCCTG
GTGGGCGAGATCATCAAGCGCTTCGAGCAGAAGGGATTCCGCCTTGTGGCCATGAAGTTC
CTTCAGGCCTCTGAGGAACTCCTGAAGCAGCACTACATTGACCTGAAAGACCGCCCATTC
TTTCCCGGCCTGGTGAAGTACATGAACTCAGGGCCAGTTGTGGCCATGGTCTGGGAGGGC
CTGAATGTAGTGAAGACAGGACGAGTGATGCTTGGGGAGACCAACCCAGCAGATTCTAAG
CCGGGCACCATTCGTGGTGACTTCTGCATTCAAGTTGGCAGGAACATCATTCATGGCAGT
GATTCAGTAAAAAGTGCTGAGAAAGAGATCAACTTGTGGTTTAAGCCCGAAGAATTGATT
GAATACAAGCCTTGTGCTTTTGACTGGATATATGAATAA
Protein Properties
Number of Residues 152
Molecular Weight 17316.0
Theoretical pI 8.22
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>Nucleoside diphosphate kinase B
MAHAERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLQASEELLKQHYIDLKDRPF
FPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGS
DSVKSAEKEINLWFKPEELIEYKPCAFDWIYE
GenBank ID Protein AAI02301.1
UniProtKB/Swiss-Prot ID Q3T0Q4
UniProtKB/Swiss-Prot Entry Name NDKB_BOVIN
PDB IDs
GenBank Gene ID BC102300
GeneCard ID NME2
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available