Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00553
Secondary Accession Numbers None
Name Arginase-1
Synonyms Not Available
Gene Name ARG1
Protein Type Enzyme
Biological Properties
General Function Amino acid transport and metabolism
Specific Function Not Available
Pathways
  • Arginine and Proline Metabolism
  • L-ornithine and urea from L-arginine: step 1/1
  • Nitrogen metabolism
  • Urea Cycle
Reactions
L-Arginine + Water → Ornithine + Urea details
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 9
Locus Not Available
SNPs ARG1
Gene Sequence
>969 bp
ATGAGTTCCAAGCCACAGTCCATCGGGGTCATTGGAGCTCCCTTCTCAAAGGGCCAGCCA
CGAGGAGGGGTGGAAGAAGGCCCTACAGTACTTAGAAAGGCTGGTCTGCTTGAGAAACTT
AAAGAACTAGAGTGTGATGTGAAAGATTATGGGGACCTGTCCTTTGCTGATAATCTTGAT
GACAGTCCCTTTCAAATTGTGAAGAATCCAAGGTGTGTGGGAAAAGCAAGTGAAAAGCTG
GCTGATGTGGTGGCAGAAGTCAAGAAGACTGGAAGGATCAGCCTTGTCCTGGGCGGAGAC
CACAGTTTGGCGATCGGCAGCATCTCTGGCCATGCCAGGGTCCACCCAGACCTCTGTGTC
ATTTGGGTGGATGCTCACACGGACATCAACACTCCACTGACAACCAAAACCGGGAACTTG
CATGGACAACCTGTGTCTTTCCTTCTGAAGGAACTAAAGGAAAAGATGCCTGAGGTCCCA
GGATTCTACTGGGTGGCTCCCTGCATATCTGCCAAAGACATTGTGTATATTGGTCTGAGA
GATGTGGACCCTGGGGAACACTATATTTTGAAAACTCTGGGAATTAAATACTTTTCAATG
ACTGAAGTGGATAAACTGGGAATTGGCAAGGTGATGGAAGAAACATTCAGCTATCTACTA
GGAAGAAAGAAAAGGCCAATTCATTTGAGCTTTGATGTTGATGGACTGGACCCATCTTTC
ACGCCAGCTACTGGCACACCAGTCCAGGGAGGTCTGACTTACAGAGAAGGTCTCTACATC
ACAGAAGAAATTTACAAAACAGGTTTACTCTCAGGATTAGATATAATGGAAGTGAATCCG
TCTCTGGGGAAGACACCAGAAGAAGTGACTCGAACAGTGAACACAACAGTAGCAATAACC
ATGGCTTGCTTTGGGGTTGCTCGAGAGGGTAACCATAAACCTATTGATTACCTTAGCCCA
CCAAAGTAA
Protein Properties
Number of Residues 322
Molecular Weight 35009.0
Theoretical pI 6.51
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>Arginase-1
MSSKPQSIGVIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKELECDVKDYGDLSFADNLD
DSPFQIVKNPRCVGKASEKLADVVAEVKKTGRISLVLGGDHSLAIGSISGHARVHPDLCV
IWVDAHTDINTPLTTKTGNLHGQPVSFLLKELKEKMPEVPGFYWVAPCISAKDIVYIGLR
DVDPGEHYILKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPSF
TPATGTPVQGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTTVAIT
MACFGVAREGNHKPIDYLSPPK
GenBank ID Protein AAI05498.1
UniProtKB/Swiss-Prot ID Q2KJ64
UniProtKB/Swiss-Prot Entry Name ARGI1_BOVIN
PDB IDs Not Available
GenBank Gene ID BC105497
GeneCard ID ARG1
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available