Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00563
Secondary Accession Numbers None
Name Asparagine synthetase [glutamine-hydrolyzing]
Synonyms Not Available
Gene Name ASNS
Protein Type Enzyme
Biological Properties
General Function Amino acid transport and metabolism
Specific Function Not Available
Pathways
  • Amino-acid biosynthesis
  • Ammonia Recycling
  • Aspartate Metabolism
  • L-asparagine biosynthesis
  • L-asparagine from L-aspartate (L-Gln route): step 1/1
Reactions
Adenosine triphosphate + L-Aspartic acid + L-Glutamine + Water → Adenosine monophosphate + Pyrophosphate + L-Asparagine + L-Glutamic acid details
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 4
Locus Not Available
SNPs ASNS
Gene Sequence
>1686 bp
ATGTGTGGCATTTGGGCGCTCTTTGGCAGCGATGACTGCCTTTCTGTTCAGTGTCTGAGT
GCTATGAAGATTGCACACAGGGGTCCGGATGCATTCCGTTTTGAAAATGTTAATGGGTAC
ACCAATTGCTGCTTTGGATTTCACCGGTTGGCGGTAGTTGACCAGCTGTTTGGAATGCAG
CCAATTCGAGTGAAGAAATATCCTTACTTGTGGCTCTGTTACAACGGTGAAATCTACAAC
CACAAGAAGCTGCAACACCATTTTGAATTTGAATACCAGACCAAAGTGGATGGTGAAATA
ATCCTTCATCTTTATGACAAAGGAGGAATTGAACAAACAGTTTGTATGTTGGATGGAGTA
TTTGCATTTATTTTACTGGATACTGCCAATAAGAAAGTGTTCTTGGGCAGAGATACCTAT
GGAGTGAGACCTTTGTTTAAAGCCATGACAGAAGATGGATTTTTGGCCGTGTGTTCAGAA
GCTAAAGGACTGGTTAACTTGAAGCACTCCATGACTCCTTTTTTAAAAGTGGAGCCTTTT
CTGCCAGGACATTATGAAGTTTTGGACCTAAAGCCAAATGGCAAAGTGGCGTCGGTGGAA
ATGGTGAAGCACCATCACTGTAGAGACGAGCCTCTGCATGCCCTGTATGACGGCGTGGAG
AAACTCTTCCCAGGTTTTGAGATAGAAACTGTGAAGAGCAACCTCCGGATTCTTTTTGAC
AATGCCGTTAAGAAACGTTTGATGACGGACAGAAGGATTGGCTGCCTTTTATCAGGTGGC
TTGGATTCCAGTTTGGTTGCTGCCACTCTGTTGAAGCAGCTAAAAGAGGCCCAAGTTCAG
TACCCTCTCCAGACATTTGCGATTGGCATGGAAGACAGTCCCGATTTACTAGCTGCTAGA
AAGGTGGCAAATCATATTGGGAGCGAACACCATGAAGTCCTCTTTAACTCTGAGGAAGGC
ATTCAGGTCCTGGATGAAGTCATATTTTCCTTGGAAACTTATGATATTACAACAGTCCGT
GCTTCAGTAGGTATGTACTTAATTTCTAAGTACATTCGGAAGAACACAGATAGCGTGGTG
ATCTTCTCTGGAGAAGGTTCAGATGAACTTACGCAGGGTTATATATATTTTCACAAGGCT
CCTTCCCCGGAGAAAGCTGAGGAGGAGAGTGAGCGGCTTCTAAGGGAACTCTACTTGTTT
GATGTTCTCCGAGCAGATCGAACTACTGCAGCCCATGGCCTTGAATTGAGAGTCCCTTTC
TTGGATCATCGCTTTTCTTCCTACTACTTGTCTCTGCCACCAGATATGAGAGTTCCCAAG
AATGGGATAGAAAAGCATCTCCTGAGAGAGACATTTGAGGACTCCAATCTGATACCTAAA
GAGATTCTCTGGCGACCAAAAGAAGCCTTCAGTGATGGAATAACCTCAGTTAAAAATTCC
TGGTTTAGGATTTTACAGGACTATATTGAACATCAGGTTGATGATGCAGCGATGGCAAGC
GCAGCCCAGAAATTTCCCATCAATACCCCCAAAACAAAAGAAGGCTATTACTACCGTCAG
ATCTTTGAAAACCACTACCCAGGCCGTGCCGACTGGCTGCCCCATTACTGGATGCCCAGG
TGGACCAACGCCACGGACCCTTCTGCCCGCACTCTGACCCATTACAAGGCCGCTGCCAAA
GCTTAG
Protein Properties
Number of Residues 561
Molecular Weight 64220.0
Theoretical pI 6.77
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>Asparagine synthetase [glutamine-hydrolyzing]
MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDQLFGMQ
PIRVKKYPYLWLCYNGEIYNHKKLQHHFEFEYQTKVDGEIILHLYDKGGIEQTVCMLDGV
FAFILLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKGLVNLKHSMTPFLKVEPF
LPGHYEVLDLKPNGKVASVEMVKHHHCRDEPLHALYDGVEKLFPGFEIETVKSNLRILFD
NAVKKRLMTDRRIGCLLSGGLDSSLVAATLLKQLKEAQVQYPLQTFAIGMEDSPDLLAAR
KVANHIGSEHHEVLFNSEEGIQVLDEVIFSLETYDITTVRASVGMYLISKYIRKNTDSVV
IFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADRTTAAHGLELRVPF
LDHRFSSYYLSLPPDMRVPKNGIEKHLLRETFEDSNLIPKEILWRPKEAFSDGITSVKNS
WFRILQDYIEHQVDDAAMASAAQKFPINTPKTKEGYYYRQIFENHYPGRADWLPHYWMPR
WTNATDPSARTLTHYKAAAKA
GenBank ID Protein AAI16124.1
UniProtKB/Swiss-Prot ID Q1LZA3
UniProtKB/Swiss-Prot Entry Name ASNS_BOVIN
PDB IDs Not Available
GenBank Gene ID BC116123
GeneCard ID ASNS
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available