Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00606
Secondary Accession Numbers None
Name 17-beta-hydroxysteroid dehydrogenase type 6
Synonyms Not Available
Gene Name HSD17B6
Protein Type Enzyme
Biological Properties
General Function Lipid transport and metabolism
Specific Function NAD-dependent oxidoreductase with broad substrate specificity that shows both oxidative and reductive activity (in vitro). Has 17-beta-hydroxysteroid dehydrogenase activity towards various steroids (in vitro). Converts 5-alpha-androstan-3-alpha,17-beta-diol to androsterone and estradiol to estrone (in vitro). Has 3-alpha-hydroxysteroid dehydrogenase activity towards androsterone (in vitro). Has retinol dehydrogenase activity towards all-trans-retinol (in vitro). Can convert androsterone to epi-androsterone. Androsterone is first oxidized to 5-alpha-androstane-3,17-dione and then reduced to epi-andosterone. Can act on both C-19 and C-21 3-alpha-hydroxysteroids (By similarity).
Pathways
  • Retinol Metabolism
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 5
Locus Not Available
SNPs HSD17B6
Gene Sequence
>954 bp
ATGTGGCTGTACCTGGCAGTCCTCTTGGGCCTGTACTACCTCCTGCGCTGGTTCCGAGAG
AGGCAGGTGGTGAGCCACCTCCAGGACAAGTTTGTCTTCATCACGGGCTGTGACTCGGGC
TTTGGGAACCAGCTGGCCAGGCAGCTGGACCTGCGAGGCTTGAGGGTCCTGGCTGGGTGT
CTGACGGAGCAGGGGGCCGAGCAGCTGAGGAACCAGACATCAGACAGGCTGCAGACAGTG
ATTCTGGACGTCACCAAGACAGAGAGCATCGCTGCGGCCACTGAGTGGGTGAAGGAGTGT
GTTGGGGACAGAGGGCTCTGGGGTCTGGTCAACAATGCAGGCATTTTTCACTCACATGGC
TATGCTGAGTGGATAAAGATTGAGACCTACAGGGATACCCTTAGGGTGAACCTCATTGGT
GTGATAGAGGTGACCCTGAGCATGCTTCCCCTGGTCAGGAAAGCACAGGGGAGAATTGTC
AATGTCTCCAGCATTCTGGGAAGAATTGCTTTCTTTGGAGCAGTCTACAGTTGTTCCAAG
TATGGAGTGGAAGCCTTCTCAGATATTCTGAGGCGTGAGCTTCAACATTTTGGGGTGAAA
GTCAGTATGGTTGAACCTGGCTACTTCAGAACAGCAATGACAGATTGGCAGAAGTTCTCA
GAGATAATGAAACAAATCTGGAAAGAAACCCCTGCGCATATTAAGGAGACCTATGGACAG
AAGTTTTTTGATGCCTATCACGATCTCATGAAACAAGGGCTGCTGAGTTGTAGCACAAAC
CTAAACCTGGTCACCGACTGCATGGAACACGCTCTGACATCCGTGCATCCCCGCACTCGA
TACTCAGCTGGCTGGGATGCTCAGTTTTTCTTTGTCCCTCTATCTTATTTGCCTACATCC
CTGGCAGACTACATATTGACTAGATCTTGGCCCAAACCAGCCCAGGCAGTCTAA
Protein Properties
Number of Residues 317
Molecular Weight 36198.0
Theoretical pI 8.55
Pfam Domain Function Not Available
Signals
  • 1-17
Transmembrane Regions Not Available
Protein Sequence
>Hydroxysteroid 17-beta dehydrogenase 6
MWLYLAVLLGLYYLLRWFRERQVVSHLQDKFVFITGCDSGFGNQLARQLDLRGLRVLAGC
LTEQGAEQLRNQTSDRLQTVILDVTKTESIAAATEWVKECVGDRGLWGLVNNAGIFHSHG
YAEWIKIETYRDTLRVNLIGVIEVTLSMLPLVRKAQGRIVNVSSILGRIAFFGAVYSCSK
YGVEAFSDILRRELQHFGVKVSMVEPGYFRTAMTDWQKFSEIMKQIWKETPAHIKETYGQ
KFFDAYHDLMKQGLLSCSTNLNLVTDCMEHALTSVHPRTRYSAGWDAQFFFVPLSYLPTS
LADYILTRSWPKPAQAV
GenBank ID Protein AAI02627.1
UniProtKB/Swiss-Prot ID Q3T001
UniProtKB/Swiss-Prot Entry Name H17B6_BOVIN
PDB IDs Not Available
GenBank Gene ID BC102626
GeneCard ID HSD17B6
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available