Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00849
Secondary Accession Numbers None
Name UDP-glucuronosyltransferase 3A1
Synonyms Not Available
Gene Name UGT3A1
Protein Type Enzyme
Biological Properties
General Function Carbohydrate transport and metabolism
Specific Function UDP-glucuronosyltransferases catalyze phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase water solubility and enhance excretion. They are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds (By similarity).
Pathways
  • Androgen and Estrogen Metabolism
  • Porphyrin Metabolism
  • Retinol Metabolism
  • Sphingolipid Metabolism
  • Starch and Sucrose Metabolism
Reactions
Ceramide (d18:1/18:0) → Galactosylceramide (d18:1/16:0) details
Testosterone → Testosterone glucuronide details
Uridine diphosphate glucuronic acid → Isovalerylglucuronide + Uridine 5'-diphosphate details
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 20
Locus Not Available
SNPs UGT3A1
Gene Sequence
>1572 bp
ATGGCAGGGCAGCAGGCACTGCTTCTATTTGGATTTATACTGCCTGGGCTCCTGTTTTCA
GAGGCTGCCAAAATCCTAACTGTGTCCCTGGTGGGTGGAAGCCATTTTCTACTGATGCAT
CAGATCTCTCAGATTCTTCAAGATCATGGTCATAATGTCACCATGCTTCTCCAAAAGGGA
AATTTATTGCTACCAGGTTTTAAAGAGGAGGAGAAATCATACAAAGTTTTTAACTGGTTT
CTGCCTGAAGACTGTAATGAAGAATTTAAGAGGTCTTTTCATTCCTTTATGGAGAAAACT
TTTGGGGGCAGATGCAAATTTGAACACTTTTTAAATATTATGGAACTACTAGGGCATCAC
TGCAGTCATTTGCTAAGGAGAAAGGATGTCATGAAGTCTTTAAAGAATGAGAACTTCGAC
CTGGTGATAGTGGAAATGTTTGACTACTGTCCTTTCTTGGTTGCTGAGAAGCTTGGGAAG
CCATTTGTGGCCATTCTCCCTTCCGCACTGGGCACCGTGGACTTTGGGCTACCAAGCCCT
CTGTCTTATGTGCCAGTGTTCTACTCCTTGTTAACGGACCAGATGGACTTCTGGGGCCGA
GTAAAGAACTTCCTGATGTTCTTTGAGTTCTTCAAGAAGCAGTGGAAAATCCAGTCTGCA
TATGATGACACCATCAAGGAGCATTTCCCGGACGACTCTAGGCCAGTTTTGTCTCATCTT
CTAACAAAAGCAGAGCTGTGGTTTGTTAACACCGACTTTGCCTTTGATTTTGCTCGGCCC
CTGCTTCCCAACACTGTGTGTATTGGAGGTTTAATGTCCAAACCTGTTAAACCAGTACCA
CAAGAATTTGAGAATTTCATCACCAAATTTGGAGACTCTGGTTTTGTCCTTGTAAGCCTG
GGGTCCATGGTGAGTTTCATTCGGTCCCAGGAGGTTCTCAAAGAGATGAATGCTGCCTTT
GCTCATCTCCCTCAAGGGGTGATATGGAAGTATAATCCTTCTCATTGGCCCAAAGACATC
AAATTGGCCCCAAATGTGAAAATTGTGCACTGGCTTCCTCAGAATGACCTTCTGGGGCAC
CCTCGCATCCGCCTCTTTGTCAGCCATGGTGGGATGAATAGTATCATGGAGGCCATCCAA
CATGGTGTGCCCATGGTGGGGATTCCCCTCTTTGGAGACCAACATGAAAACCTGCTCCGA
GTTAAAGCCAAAAAGTTCGGTGTCTCTATCCAATTAAAGCAGATCAAGGCTGAGACACTG
GCTCTGAAGATGAAGCAAGTCATAGAGGACAAGAGGTACAAATCTGCCGCAGAGGCCGCC
AGCATCATCAGACGCTCGCAGCCCCTGACCCCTGCCCAGCGGCTGGTGGGCTGGATTAAC
CACATCCTTCAGACAGGGGGTGCAGCCCACCTCAAGCCCCATGCCTTCCAGCAGCCGTGG
TATGAGCAGTACCTACTGGACGTCTTCTTGTTCCTTCTGGTGGTCACCCTGGGCACCATG
TGGCTCTGTGGGAAGCTTCTGGGCCTGGTGGCCAGGTGGCTGTGTGGGGCCAGGAAGCTG
AAGAAGGCCTGA
Protein Properties
Number of Residues 523
Molecular Weight 59682.0
Theoretical pI 9.6
Pfam Domain Function Not Available
Signals
  • 1-22
Transmembrane Regions
  • 484-504
Protein Sequence
>UDP-glucuronosyltransferase 3A1
MAGQQALLLFGFILPGLLFSEAAKILTVSLVGGSHFLLMHQISQILQDHGHNVTMLLQKG
NLLLPGFKEEEKSYKVFNWFLPEDCNEEFKRSFHSFMEKTFGGRCKFEHFLNIMELLGHH
CSHLLRRKDVMKSLKNENFDLVIVEMFDYCPFLVAEKLGKPFVAILPSALGTVDFGLPSP
LSYVPVFYSLLTDQMDFWGRVKNFLMFFEFFKKQWKIQSAYDDTIKEHFPDDSRPVLSHL
LTKAELWFVNTDFAFDFARPLLPNTVCIGGLMSKPVKPVPQEFENFITKFGDSGFVLVSL
GSMVSFIRSQEVLKEMNAAFAHLPQGVIWKYNPSHWPKDIKLAPNVKIVHWLPQNDLLGH
PRIRLFVSHGGMNSIMEAIQHGVPMVGIPLFGDQHENLLRVKAKKFGVSIQLKQIKAETL
ALKMKQVIEDKRYKSAAEAASIIRRSQPLTPAQRLVGWINHILQTGGAAHLKPHAFQQPW
YEQYLLDVFLFLLVVTLGTMWLCGKLLGLVARWLCGARKLKKA
GenBank ID Protein AAI15989.1
UniProtKB/Swiss-Prot ID Q1LZI1
UniProtKB/Swiss-Prot Entry Name UD3A1_BOVIN
PDB IDs Not Available
GenBank Gene ID BC115988
GeneCard ID UGT3A1
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available