Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP01076
Secondary Accession Numbers
  • BMDBP03021
Name Pyruvate dehydrogenase E1 component subunit beta, mitochondrial
Synonyms Not Available
Gene Name PDHB
Protein Type Enzyme
Biological Properties
General Function Energy production and conversion
Specific Function The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2), and thereby links the glycolytic pathway to the tricarboxylic cycle.
Pathways Not Available
Reactions
Pyruvic acid + Coenzyme A + NAD → Acetyl-CoA + Carbon dioxide + NADH details
Pyruvic acid + Lipoamide → S-Acetyldihydrolipoamide-E + Carbon dioxide details
Pyruvic acid → Acetyl-CoA details
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 22
Locus Not Available
SNPs PDHB
Gene Sequence
>612 bp
ATGGCGGTGGTTGCTGTGTTGGTGCGGAAACCCCTTGAGCAGGTCTCCGGGCTGCTGAGG
AGGCGGTTCCACCGGACCGCGCCGGCTGCACTGCAGGTGACAGTTCGTGAGGCTATAAAT
CAAGGCATGGATGAGGAGCTGGAAAGAGATGAGAAGGTATTTCTCCTTGGGGAAGAAGTT
GCCCAGTACGATGGGGCATATAAGGTTAGTCGAGGCCTGTGGAAGAAATATGGAGATAAG
AGGATCATAGATACTCCCATATCTGAGATGGGCTTTGCTGGAATTGCTGTAGGTGCCGCT
ATGGCTGGGTTACGGCCCATTTGTGAATTCATGACCTTCAATTTCTCTATGCAAGCCATC
GACCAGGTCATAAACTCAGCTGCCAAGACGTACTACATGTCAGGGGGCCTTCAGTCTGTG
CCCATAGTCTTCAGGGGGCCCAATGGCGCCTCAGCAGGTGTAGCTGCCCAGCACTCACAG
TGTTTTGCTGCCTGGTATGGGCATTGCCCAGGCTTAAAGGTGGTCAGCCCCTGGAGTTCA
GAGGATGCAAAAGGGCTTATTAAATCAGCCATTCGGGATAACAACCCAGTGGTGGTGCTG
AGAATGAATTGA
Protein Properties
Number of Residues 359
Molecular Weight 39126.0
Theoretical pI 6.63
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • 282-302
  • 371-391
Protein Sequence
>Pyruvate dehydrogenase E1 component subunit beta, mitochondrial
MAVVAVLVRKPLEQVSGLLRRRFHRTAPAALQVTVREAINQGMDEELERDEKVFLLGEEV
AQYDGAYKVSRGLWKKYGDKRIIDTPISEMGFAGIAVGAAMAGLRPICEFMTFNFSMQAI
DQVINSAAKTYYMSGGLQSVPIVFRGPNGASAGVAAQHSQCFAAWYGHCPGLKVVSPWSS
EDAKGLIKSAIRDNNPVVVLENELMYGVPFELPSEAQSKDFLIPIGKAKIERQGTHVTIV
AHSRPVGHCLEAATVLSKEGIECEVINLRTIRPMDIETIEGSVMKTNHLVTVEGGWPQFG
VGAEICARIMEGPAFNFLDAPAVRVTGADVPMPYAKILEDNSVPQVKDIIFAIKKTLNI
GenBank ID Protein AAX46758.1
UniProtKB/Swiss-Prot ID P11966
UniProtKB/Swiss-Prot Entry Name ODPB_BOVIN
PDB IDs Not Available
GenBank Gene ID BT021911
GeneCard ID PDHB
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available