You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP01290
Secondary Accession Numbers
  • BMDBP03086
Name Dihydrodiol dehydrogenase 3
Synonyms Not Available
Gene Name Not Available
Protein Type Enzyme
Biological Properties
General Function Involved in oxidoreductase activity
Specific Function Not Available
Pathways Not Available
Reactions
7a-Hydroxy-5b-cholestan-3-one + NAD → 3a,7a-Dihydroxy-5b-cholestane + NADP details
7a-Hydroxy-cholestene-3-one + NADPH → 7a-Hydroxy-5b-cholestan-3-one + NADP details
7a,12a-Dihydroxy-cholestene-3-one + NADPH → 7a,12a-Dihydroxy-5b-cholestan-3-one + NADP details
7a,12a-Dihydroxy-5b-cholestan-3-one + NADP → 5-b-Cholestane-3a ,7a ,12a-triol + NADPH details
Tetrahydrocorticosterone + NADP → 11b,21-Dihydroxy-5b-pregnane-3,20-dione + NADPH details
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 13
Locus Not Available
SNPs Not Available
Gene Sequence
>972 bp
ATGGATCCCAAAGGCCAGAGAGTGAAGCTTAATGATGGCCACTTCATTCCTGTCCTGGGA
TTTGGAACCTTTGCACCTCGAGAGGTTCCTAAGAGTGAAGCTCTGGAAGTCACCAAATTT
GCTATAGAGGCTGGGTTCCGCCATATTGACAGTGCTCATTTGTACCAAAATGAAGAGCAG
GTTGGCCAGGCCATTCGAAGCAAGATTGCCGATGGCACTGTAAAGAGAGAAGACATTTTC
TACACTTCAAAGCTTTGGTCCACTTCCCTTCGTCCAGAATTGGTCCGACCAGCCTTGGAA
AAGTCACTGAATAATCTTCAACTGGACTATGTCGATCTTTATATTATTCATTTTCCAGTG
GCTCTGAAGCCAGGGGAGACACTTTTCCCAACAGATGAAAATGGAAAACCAATATTTGAC
TCAGTGGATCTCTGTCGCACATGGGAGGCCCTGGAGAAGTGTAAGGACGCAGGGCTGACC
AAGTCCATCGGGGTGTCCAACTTCAACCACAAGCAGCTGGAGAAGATCCTGAACAAGCCA
GGGCTTAAGTACAAGCCCGTCTGCAACCAGGTGGAATGTCACCCTTATTTCAATCAGAGC
AAACTGTTGGATTTCTGCAAGTCACATGATATTGTTCTTGTTGCCTATGGTGCTCTGGGA
TCCCAACGACTAAAAGAATGGGTGAACCCAAACCTCCCCTTTCTCTTGGAGGACCCAGTT
CTCTCTGCCATTGCCAAAAAGCACAGGCAAACCCCAGCTCTGGTTGCCCTTCGCTACCAG
ATACAACGTGGGGTTGTGGTTCTGGCCAAGAGTTACAACAAGAAGCGGATCAAAGAGAAC
ATACAGGTGTTTGACTTTGAACTGACTCCAGAAGATATGAAAGCAATCGATGGCCTCAAC
AGCAATATGAGATATAATGAGCTATTACTGGGTGTTGGTCACCCTGAGTATCCATTTGTT
GAAGAATATTGA
Protein Properties
Number of Residues 323
Molecular Weight 36784.0
Theoretical pI 7.92
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>Dihydrodiol dehydrogenase 3
MDPKGQRVKLNDGHFIPVLGFGTFAPREVPKSEALEVTKFAIEAGFRHIDSAHLYQNEEQ
VGQAIRSKIADGTVKREDIFYTSKLWSTSLRPELVRPALEKSLNNLQLDYVDLYIIHFPV
ALKPGETLFPTDENGKPIFDSVDLCRTWEALEKCKDAGLTKSIGVSNFNHKQLEKILNKP
GLKYKPVCNQVECHPYFNQSKLLDFCKSHDIVLVAYGALGSQRLKEWVNPNLPFLLEDPV
LSAIAKKHRQTPALVALRYQIQRGVVVLAKSYNKKRIKENIQVFDFELTPEDMKAIDGLN
SNMRYNELLLGVGHPEYPFVEEY
GenBank ID Protein BAA08493.1
UniProtKB/Swiss-Prot ID P52898
UniProtKB/Swiss-Prot Entry Name DDBX_BOVIN
PDB IDs Not Available
GenBank Gene ID D49542
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available