Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00024
Secondary Accession Numbers
  • BMDBP03084
Name Prostacyclin synthase
Synonyms Not Available
Gene Name PTGIS
Protein Type Enzyme
Biological Properties
General Function Secondary metabolites biosynthesis, transport and catabolism
Specific Function Catalyzes the isomerization of prostaglandin H2 to prostacyclin (= prostaglandin I2).
Pathways Not Available
Reactions
Prostaglandin H2 → Prostaglandin I2 details
7a-Hydroxy-cholestene-3-one + NADPH + Oxygen → 7a,12a-Dihydroxy-cholestene-3-one + NADP + Water details
Cholesterol + 3 NADPH + 3 Oxygen → 27-Hydroxycholesterol +3 NADP +4 Water details
27-Hydroxycholesterol + NADPH + Oxygen → 7-a,27-dihydroxycholesterol + NADP + Water details
3beta-Hydroxy-5-cholestenoic acid + NADPH + Oxygen → 3 beta,7 alpha-Dihydroxy-5-cholestenoate + NADP + Water details
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 13
Locus Not Available
SNPs PTGIS
Gene Sequence
>1503 bp
ATGTCCTGGGCCGTGGTCTTCGGCCTCCTGGCCGCGCTGCTGCTGCTGCTGCTGCTGACC
CGCCGCCGCACGCGGCGACCTGGCGAGCCTCCCCTGGACCTGGGCAGTATCCCCTGGCTG
GGTCACGCCTTGGAGTTTGGAAAAGATGCTGCCGGCTTCCTCACTAGGATGAAGGAGAAG
CATGGGGACATCTTTACTGTGCTGGTGGGCGGCAGGCACGTCACGGTCCTCCTGGATCCC
CACTCCTACGACGCGGTGGTGTGGGAGCCCCGCAGCAGGCTGGACTTCCACGCCTACGCC
GTCTTCCTCATGGAGAGGATTTTCGACGTGCAGCTTCCGCATTATAACCCCGGTGATGAA
AAGTCCAAGATGAAACCGACTCTCCTCCACAAAGAGCTGCAGGCGCTCACGGATGCCATG
TATACCAACCTCCGCACTGTCCTGCTGGGTGACACCGTGGAAGCGGGCAGTGGCTGGCAC
GAAATGGGGCTCCTCGAGTTCTCCTACGGCTTCCTGCTCAGAGCCGGCTACCTGACCCAG
TACGGCGTTGAGGCACCGCCACACACCCAGGAGAGCCAGGCCCAGGACCGTGTCCACTCA
GCCGACGTCTTCCACACCTTCCGCCAGCTTGACCTGCTGCTCCCCAAGCTGGCACGTGGC
TCCCTGTCAGCGGGGGATAAGGACCGGGTGGGCAAGGTCAAAGGTCGCCTGTGGAAGCTG
TTGTCCCCAACCAGGCTGGCCAGCCGGGCCCACCGGAGCAGATGGCTGGAGAGTTACCTG
CTGCACCTGGAGGAGATGGGCGTGTCGGAGGAGATGCAGGCTCGCGCCCTGGTGCTGCAG
CTCTGGGCCACACAGGGGAACATGGGTCCTGCTGCCTTCTGGCTCCTGCTCTTTCTCCTC
AAGAACCCCGAGGCCCTGGCCGCTGTCCGTGGAGAGCTAGAGACTGTCCTTTTGGGAGCA
GAGCAGCCCATATCACAGATGACCACCCTCCCACAGAAAGTTTTGGACAGCATGCCTGTG
CTGGACAGCGTGCTGAGTGAGAGCCTCAGGCTCACCGCCGCGCCCTTCATCACCCGCGAG
GTCGTGGCCGACCTGGCCTTGCCCATGGCGGATGGGCGGGAATTCAGCCTGCGACGTGGG
GACCGCCTCCTCCTCTTTCCCTTCCTGAGTCCCCAGAAGGACCCGGAGATCTACACAGAC
CCGGAGGTATTTAAATACAACCGATTCCTGAACCCTGATGGATCAGAGAAGAAAGACTTT
TACAAAGATGGGAAGCGACTGAAGAACTACAGCTTGCCGTGGGGAGCAGGGCATAACCAG
TGCCTGGGGAAGGGTTACGCCGTCAACAGCATCAAACAATTCGTGTTCCTTGTGCTGACG
CAGTTTGACCTGGAGCTGATCACCCCGGACGTGGACATCCCCGAGTTTGACCTCAGCAGG
TATGGCTTTGGGCTGATGCAGCCGGAACACGATGTGCCTGTCCGTTACCGCATCCGGCCG
TGA
Protein Properties
Number of Residues 500
Molecular Weight 56629.0
Theoretical pI 7.29
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • 1-20
Protein Sequence
>Prostacyclin synthase
MSWAVVFGLLAALLLLLLLTRRRTRRPGEPPLDLGSIPWLGHALEFGKDAAGFLTRMKEK
HGDIFTVLVGGRHVTVLLDPHSYDAVVWEPRSRLDFHAYAVFLMERIFDVQLPHYNPGDE
KSKMKPTLLHKELQALTDAMYTNLRTVLLGDTVEAGSGWHEMGLLEFSYGFLLRAGYLTQ
YGVEAPPHTQESQAQDRVHSADVFHTFRQLDLLLPKLARGSLSAGDKDRVGKVKGRLWKL
LSPTRLASRAHRSRWLESYLLHLEEMGVSEEMQARALVLQLWATQGNMGPAAFWLLLFLL
KNPEALAAVRGELETVLLGAEQPISQMTTLPQKVLDSMPVLDSVLSESLRLTAAPFITRE
VVADLALPMADGREFSLRRGDRLLLFPFLSPQKDPEIYTDPEVFKYNRFLNPDGSEKKDF
YKDGKRLKNYSLPWGAGHNQCLGKGYAVNSIKQFVFLVLTQFDLELITPDVDIPEFDLSR
YGFGLMQPEHDVPVRYRIRP
GenBank ID Protein BAA06383.1
UniProtKB/Swiss-Prot ID Q29626
UniProtKB/Swiss-Prot Entry Name PTGIS_BOVIN
PDB IDs Not Available
GenBank Gene ID D30718
GeneCard ID PTGIS
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available