Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00359
Secondary Accession Numbers None
Name Hydroxymethylglutaryl-CoA synthase, mitochondrial
Synonyms Not Available
Gene Name HMGCS2
Protein Type Enzyme
Biological Properties
General Function Lipid transport and metabolism
Specific Function This enzyme condenses acetyl-CoA with acetoacetyl-CoA to form HMG-CoA, which is the substrate for HMG-CoA reductase.
Pathways
  • (R)-mevalonate biosynthesis
  • (R)-mevalonate from acetyl-CoA: step 2/3
  • Butyrate Metabolism
  • Ketone Body Metabolism
  • Metabolic intermediate biosynthesis
  • Valine, Leucine, and Isoleucine Degradation
Reactions
Acetyl-CoA + Acetoacetyl-CoA + Water → 3-Hydroxy-3-methylglutaryl-CoA + Coenzyme A details
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 3
Locus Not Available
SNPs HMGCS2
Gene Sequence
>1527 bp
ATGCAGCGGCTGTTGACTCCAGTGAGGCAGGTGTTGCAAGTGAAGAGAGTGATGCAAGAA
GCTTCCCTCCTGCCTGCCCGCCTTCTCCCAGCAGCCCACCCCAGTTTTTCTACAGTTCCG
GCTGTCCCCTTGGCCAAAACAGATACTTGGCCAAAGGATGTGGGTATTCTTGCCATGGAG
GTCTACTTTCCAGCCCAATATGTGGACCAAACAGAGCTGGAGAAGTTTAACAAAGTGGAG
GCAGGGAGGTACACCGTGGGCTTGGGCCAGACCCAGATGGGCTTCTGCTCAGTCCAGGAG
GATGTCAACTCCCTGTGCCTGACGGTGGTGCAACAGCTGATGGAGCGCACGCAGCTCCCC
TGGGACTCTGTGGGCCGCCTGGAAGTGGGCACTGAGACCATCATCGATAAGTCCAAGGCT
GTCAAAACAGTGCTTATGGAGCTCTTCCAGGATTCAGGCAACACTGACATTGAGGGCATA
GATACCACCAATGCCTGCTACGGTGGCACTGCCTCCCTCTTCAATGCTGCCAACTGGATG
GAATCCAGCTCCTGGGATGGTCGCTATGCACTGGTGGTCTGTGGGGACATCGCAGTCTAC
CCCAGTGGTAACGCTCGCCCCACAGGCGGGGCTGGAGCTGTGGCAATGCTGGTTGGGCCT
GAGGCCCCTCTGGTCCTCGAGAGAGGGCTTAGAGGAACCCACATGGAGAATGTGTACGAC
TTCTACAAACCAGATGTGACTTCAGAGTACCCACTGGTGGATGGGAAGCTCTCCATCCAG
TGCTACTTACGGGCCCTGGACAAATGCTATGCATTCTACCGTCAAAAGATCGAGAAACAG
TGGAAGCAAGCTGGCATCGATCGGCCTTTCACTCTCGATGATGTGCAGTATATGATTTTT
CACACGCCTTTCTGCAAGTTAGTCCAGAAATCCCTGGCCCGCCTGATGTTCAATGACTTC
CTGTTGGCCAGTGGTGACACACAGACTGGCATCTACAAGGGCTTGGAGGCCTTCAGGGGA
CTAAAGCTGGAAGACACCTACACCAATAAGGATGTAGATAAAGCATTTCTAAAAGCCTCT
CTGAACATGTTCAATAAGAAAACCAAGAACTCCCTCTACCTCTCCACGTACAACGGGAAT
ATGTACACCTCATCCCTATATGGATGCCTGGCCTCACTTCTGGCCCATCACTCTGCCCAA
GACTTGGCTGGCTCCAGGATCGGTGCCTTCTCTTATGGCTCTGGTTTGGCAGCAAGTTTC
TTTTCTTTCCGGGTGTCCCAGGATGCTTCTCCAGGCTCCCCACTGGAGAAGCTGGTATCC
AGTACATCAGACCTGCAGAAACGTCTTGCCTCCCGGAAGCGTGTGTCTCCTGAGGAGTTC
ACAGAAATAATGAACCAAAGAGAACAATACTACCACAAGATGAATTTCTCACCACCTGGT
GATAAGAACAGCCTTTTCCCAGGCACTTGGTACCTGGAGCGAGTGGATGAGCTGTATCGC
AGGAAGTACGCCCGGCGTCCCGTTTAA
Protein Properties
Number of Residues 508
Molecular Weight 56895.0
Theoretical pI 8.16
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • 34-54
  • 84-105
  • 117-134
  • 140-160
  • 172-191
  • 245-266
  • 272-294
  • 362-386
  • 406-432
  • 453-472
  • 484-502
  • 586-604
Protein Sequence
>Hydroxymethylglutaryl-CoA synthase, mitochondrial
MQRLLTPVRQVLQVKRVMQEASLLPARLLPAAHPSFSTVPAVPLAKTDTWPKDVGILAME
VYFPAQYVDQTELEKFNKVEAGRYTVGLGQTQMGFCSVQEDVNSLCLTVVQQLMERTQLP
WDSVGRLEVGTETIIDKSKAVKTVLMELFQDSGNTDIEGIDTTNACYGGTASLFNAANWM
ESSSWDGRYALVVCGDIAVYPSGNARPTGGAGAVAMLVGPEAPLVLERGLRGTHMENVYD
FYKPDVTSEYPLVDGKLSIQCYLRALDKCYAFYRQKIEKQWKQAGIDRPFTLDDVQYMIF
HTPFCKLVQKSLARLMFNDFLLASGDTQTGIYKGLEAFRGLKLEDTYTNKDVDKAFLKAS
LNMFNKKTKNSLYLSTYNGNMYTSSLYGCLASLLAHHSAQDLAGSRIGAFSYGSGLAASF
FSFRVSQDASPGSPLEKLVSSTSDLQKRLASRKRVSPEEFTEIMNQREQYYHKMNFSPPG
DKNSLFPGTWYLERVDELYRRKYARRPV
GenBank ID Protein AAI12667.1
UniProtKB/Swiss-Prot ID Q2KIE6
UniProtKB/Swiss-Prot Entry Name HMCS2_BOVIN
PDB IDs Not Available
GenBank Gene ID BC112666
GeneCard ID HMGCS2
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available