Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00391
Secondary Accession Numbers None
Name Ethanolaminephosphotransferase 1
Synonyms Not Available
Gene Name SELENOI
Protein Type Enzyme
Biological Properties
General Function Involved in ethanolaminephosphotransferase activity
Specific Function Catalyzes phosphatidylethanolamine biosynthesis from CDP-ethanolamine. It thereby plays a central role in the formation and maintenance of vesicular membranes. Involved in the foramtion of phosphatidylethanolamine via 'Kennedy' pathway (By similarity).
Pathways
  • Phosphatidylcholine Biosynthesis
  • Phosphatidylcholine Biosynthesis PC(14:0/14:0)
  • Phosphatidylcholine Biosynthesis PC(14:0/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/15:0)
  • Phosphatidylcholine Biosynthesis PC(14:0/16:0)
  • Phosphatidylcholine Biosynthesis PC(14:0/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/18:0)
  • Phosphatidylcholine Biosynthesis PC(14:0/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/20:0)
  • Phosphatidylcholine Biosynthesis PC(14:0/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/22:0)
  • Phosphatidylcholine Biosynthesis PC(14:0/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/24:0)
  • Phosphatidylcholine Biosynthesis PC(14:0/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/15:0)
  • Phosphatidylcholine Biosynthesis PC(15:0/16:0)
  • Phosphatidylcholine Biosynthesis PC(15:0/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/18:0)
  • Phosphatidylcholine Biosynthesis PC(15:0/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/20:0)
  • Phosphatidylcholine Biosynthesis PC(15:0/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/22:0)
  • Phosphatidylcholine Biosynthesis PC(15:0/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/24:0)
  • Phosphatidylcholine Biosynthesis PC(15:0/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/16:0)
  • Phosphatidylcholine Biosynthesis PC(16:0/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/18:0)
  • Phosphatidylcholine Biosynthesis PC(16:0/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/20:0)
  • Phosphatidylcholine Biosynthesis PC(16:0/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/22:0)
  • Phosphatidylcholine Biosynthesis PC(16:0/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/24:0)
  • Phosphatidylcholine Biosynthesis PC(16:0/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/18:0)
  • Phosphatidylcholine Biosynthesis PC(18:0/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/20:0)
  • Phosphatidylcholine Biosynthesis PC(18:0/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/22:0)
  • Phosphatidylcholine Biosynthesis PC(18:0/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/24:0)
  • Phosphatidylcholine Biosynthesis PC(18:0/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/20:0)
  • Phosphatidylcholine Biosynthesis PC(20:0/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:0/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:0/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/22:0)
  • Phosphatidylcholine Biosynthesis PC(22:0/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/24:0)
  • Phosphatidylcholine Biosynthesis PC(22:0/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/24:0)
  • Phosphatidylcholine Biosynthesis PC(24:0/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis
  • Phosphatidylethanolamine Biosynthesis PE(14:0/14:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:0/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:0/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:0/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:0/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:0/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:0/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:0/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:0/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/14:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(14:1(9Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/15:0)
  • Phosphatidylethanolamine Biosynthesis PE(15:0/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(15:0/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(15:0/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(15:0/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(15:0/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(15:0/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(15:0/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/16:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:0/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:0/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:0/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:0/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:0/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:0/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/16:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(16:1(9Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/18:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:0/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:0/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:0/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:0/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:0/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/18:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(11Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/18:1(9Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:1(9Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/18:2(9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:2(9Z,12Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(6Z,9Z,12Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:3(9Z,12Z,15Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(18:4(6Z,9Z,12Z,15Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/20:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:0/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:0/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:0/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:0/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/20:1(11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:1(11Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/20:2(11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:2(11Z,14Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(5Z,8Z,11Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:3(8Z,11Z,14Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(5Z,8Z,11Z,14Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:4(8Z,11Z,14Z,17Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(20:5(5Z,8Z,11Z,14Z,17Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/22:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:0/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:0/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:0/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/22:1(13Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:1(13Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/22:2(13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:2(13Z,16Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:4(7Z,10Z,13Z,16Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(4Z,7Z,10Z,13Z,16Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:5(7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:0/24:0)
  • Phosphatidylethanolamine Biosynthesis PE(24:0/24:1(15Z))
  • Phosphatidylethanolamine Biosynthesis PE(24:1(15Z)/24:1(15Z))
  • Phosphatidylethanolamine from ethanolamine: step 3/3
  • Phospholipid metabolism
Reactions
CDP-Ethanolamine + 1,2-Diacyl-sn-glycerol → an L-1-Phosphatidylethanolamine + Cytidine monophosphate details
CDP-Ethanolamine + DG(16:0/16:0/0:0) → Cytidine monophosphate + PE(16:0/16:0) details
CDP-Ethanolamine + DG(14:0/14:0/0:0) → Cytidine monophosphate + PE(14:0/14:0) details
CDP-Ethanolamine + DG(14:0/14:1(9Z)/0:0) → Cytidine monophosphate + PE(14:0/14:1(9Z)) details
CDP-Ethanolamine + DG(14:0/15:0/0:0) → Cytidine monophosphate + PE(14:0/15:0) details
CDP-Ethanolamine + DG(14:0/16:0/0:0) → Cytidine monophosphate + PE(14:0/16:0) details
CDP-Ethanolamine + DG(14:0/16:1(9Z)/0:0) → Cytidine monophosphate + PE(14:0/16:1(9Z)) details
CDP-Ethanolamine + DG(14:0/18:0/0:0) → Cytidine monophosphate + PE(14:0/18:0) details
CDP-Ethanolamine + DG(14:0/18:1(11Z)/0:0) → Cytidine monophosphate + PE(14:0/18:1(11Z)) details
CDP-Ethanolamine + DG(14:0/18:1(9Z)/0:0) → Cytidine monophosphate + PE(14:0/18:1(9Z)) details
CDP-Ethanolamine + DG(14:0/18:2(9Z,12Z)/0:0) → Cytidine monophosphate + PE(14:0/18:2(9Z,12Z)) details
CDP-Ethanolamine + DG(14:0/18:3(6Z,9Z,12Z)/0:0) → Cytidine monophosphate + PE(14:0/18:3(6Z,9Z,12Z)) details
CDP-Ethanolamine + DG(14:0/18:3(9Z,12Z,15Z)/0:0) → Cytidine monophosphate + PE(14:0/18:3(9Z,12Z,15Z)) details
CDP-Ethanolamine + DG(14:0/18:4(6Z,9Z,12Z,15Z)/0:0) → Cytidine monophosphate + PE(14:0/18:4(6Z,9Z,12Z,15Z)) details
CDP-Ethanolamine + DG(14:0/20:0/0:0) → Cytidine monophosphate + PE(14:0/20:0) details
CDP-Ethanolamine + DG(14:0/20:1(11Z)/0:0) → Cytidine monophosphate + PE(14:0/20:1(11Z)) details
CDP-Ethanolamine + DG(14:0/20:2(11Z,14Z)/0:0) → Cytidine monophosphate + PE(14:0/20:2(11Z,14Z)) details
CDP-Ethanolamine + DG(14:0/20:3(5Z,8Z,11Z)/0:0) → Cytidine monophosphate + PE(14:0/20:3(5Z,8Z,11Z)) details
CDP-Ethanolamine + DG(14:0/20:3(8Z,11Z,14Z)/0:0) → Cytidine monophosphate + PE(14:0/20:3(8Z,11Z,14Z)) details
CDP-Ethanolamine + DG(14:0/20:4(5Z,8Z,11Z,14Z)/0:0) → Cytidine monophosphate + PE(14:0/20:4(5Z,8Z,11Z,14Z)) details
CDP-Ethanolamine + DG(14:0/20:4(8Z,11Z,14Z,17Z)/0:0) → Cytidine monophosphate + PE(14:0/20:4(8Z,11Z,14Z,17Z)) details
CDP-Ethanolamine + DG(14:0/20:5(5Z,8Z,11Z,14Z,17Z)/0:0) → Cytidine monophosphate + PE(14:0/20:5(5Z,8Z,11Z,14Z,17Z)) details
CDP-Ethanolamine + DG(14:0/22:0/0:0) → Cytidine monophosphate + PE(14:0/22:0) details
CDP-Ethanolamine + DG(14:0/22:1(13Z)/0:0) → Cytidine monophosphate + PE(14:0/22:1(13Z)) details
CDP-Ethanolamine + DG(14:0/22:2(13Z,16Z)/0:0) → Cytidine monophosphate + PE(14:0/22:2(13Z,16Z)) details
CDP-Ethanolamine + DG(14:0/22:4(7Z,10Z,13Z,16Z)/0:0) → Cytidine monophosphate + PE(14:0/22:4(7Z,10Z,13Z,16Z)) details
CDP-Ethanolamine + DG(14:0/22:5(4Z,7Z,10Z,13Z,16Z)/0:0) → Cytidine monophosphate + PE(14:0/22:5(4Z,7Z,10Z,13Z,16Z)) details
CDP-Ethanolamine + DG(14:0/22:5(7Z,10Z,13Z,16Z,19Z)/0:0) → Cytidine monophosphate + PE(14:0/22:5(7Z,10Z,13Z,16Z,19Z)) details
CDP-Ethanolamine + DG(14:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/0:0) → Cytidine monophosphate + PE(14:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)) details
CDP-Ethanolamine + DG(14:0/24:0/0:0) → Cytidine monophosphate + PE(14:0/24:0) details
CDP-Ethanolamine + DG(14:0/24:1(15Z)/0:0) → Cytidine monophosphate + PE(14:0/24:1(15Z)) details
CDP-Ethanolamine + DG(14:1(9Z)/14:1(9Z)/0:0) → Cytidine monophosphate + PE(14:1(9Z)/14:1(9Z)) details
CDP-Ethanolamine + DG(14:1(9Z)/15:0/0:0) → Cytidine monophosphate + PE(14:1(9Z)/15:0) details
CDP-Ethanolamine + DG(14:1(9Z)/16:0/0:0) → Cytidine monophosphate + PE(14:1(9Z)/16:0) details
CDP-Ethanolamine + DG(14:1(9Z)/16:1(9Z)/0:0) → Cytidine monophosphate + PE(14:1(9Z)/16:1(9Z)) details
CDP-Ethanolamine + DG(14:1(9Z)/18:0/0:0) → Cytidine monophosphate + PE(14:1(9Z)/18:0) details
CDP-Ethanolamine + DG(14:1(9Z)/18:1(11Z)/0:0) → Cytidine monophosphate + PE(14:1(9Z)/18:1(11Z)) details
CDP-Ethanolamine + DG(14:1(9Z)/18:1(9Z)/0:0) → Cytidine monophosphate + PE(14:1(9Z)/18:1(9Z)) details
CDP-Ethanolamine + DG(14:1(9Z)/18:2(9Z,12Z)/0:0) → Cytidine monophosphate + PE(14:1(9Z)/18:2(9Z,12Z)) details
CDP-Ethanolamine + DG(14:1(9Z)/18:3(6Z,9Z,12Z)/0:0) → Cytidine monophosphate + PE(14:1(9Z)/18:3(6Z,9Z,12Z)) details
CDP-Ethanolamine + DG(14:1(9Z)/18:3(9Z,12Z,15Z)/0:0) → Cytidine monophosphate + PE(14:1(9Z)/18:3(9Z,12Z,15Z)) details
CDP-Ethanolamine + DG(14:1(9Z)/18:4(6Z,9Z,12Z,15Z)/0:0) → Cytidine monophosphate + PE(14:1(9Z)/18:4(6Z,9Z,12Z,15Z)) details
CDP-Ethanolamine + DG(14:1(9Z)/20:0/0:0) → Cytidine monophosphate + PE(14:1(9Z)/20:0) details
CDP-Ethanolamine + DG(14:1(9Z)/20:1(11Z)/0:0) → Cytidine monophosphate + PE(14:1(9Z)/20:1(11Z)) details
CDP-Ethanolamine + DG(14:1(9Z)/20:2(11Z,14Z)/0:0) → Cytidine monophosphate + PE(14:1(9Z)/20:2(11Z,14Z)) details
CDP-Ethanolamine + DG(14:1(9Z)/20:3(5Z,8Z,11Z)/0:0) → Cytidine monophosphate + PE(14:1(9Z)/20:3(5Z,8Z,11Z)) details
CDP-Ethanolamine + DG(14:1(9Z)/20:3(8Z,11Z,14Z)/0:0) → Cytidine monophosphate + PE(14:1(9Z)/20:3(8Z,11Z,14Z)) details
CDP-Ethanolamine + DG(14:1(9Z)/20:4(5Z,8Z,11Z,14Z)/0:0) → Cytidine monophosphate + PE(14:1(9Z)/20:4(5Z,8Z,11Z,14Z)) details
CDP-Ethanolamine + DG(14:1(9Z)/20:4(8Z,11Z,14Z,17Z)/0:0) → Cytidine monophosphate + PE(14:1(9Z)/20:4(8Z,11Z,14Z,17Z)) details
CDP-Ethanolamine + DG(14:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z)/0:0) → Cytidine monophosphate + PE(14:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z)) details
CDP-Ethanolamine + DG(14:1(9Z)/22:0/0:0) → Cytidine monophosphate + PE(14:1(9Z)/22:0) details
CDP-Ethanolamine + DG(14:1(9Z)/22:1(13Z)/0:0) → Cytidine monophosphate + PE(14:1(9Z)/22:1(13Z)) details
CDP-Ethanolamine + DG(14:1(9Z)/22:2(13Z,16Z)/0:0) → Cytidine monophosphate + PE(14:1(9Z)/22:2(13Z,16Z)) details
CDP-Ethanolamine + DG(14:1(9Z)/22:4(7Z,10Z,13Z,16Z)/0:0) → Cytidine monophosphate + PE(14:1(9Z)/22:4(7Z,10Z,13Z,16Z)) details
CDP-Ethanolamine + DG(14:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/0:0) → Cytidine monophosphate + PE(14:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)) details
CDP-Ethanolamine + DG(14:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/0:0) → Cytidine monophosphate + PE(14:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)) details
CDP-Ethanolamine + DG(14:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/0:0) → Cytidine monophosphate + PE(14:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)) details
CDP-Ethanolamine + DG(14:1(9Z)/24:0/0:0) → Cytidine monophosphate + PE(14:1(9Z)/24:0) details
CDP-Ethanolamine + DG(14:1(9Z)/24:1(15Z)/0:0) → Cytidine monophosphate + PE(14:1(9Z)/24:1(15Z)) details
CDP-Ethanolamine + DG(15:0/15:0/0:0) → Cytidine monophosphate + PE(15:0/15:0) details
CDP-Ethanolamine + DG(15:0/16:0/0:0) → Cytidine monophosphate + PE(15:0/16:0) details
CDP-Ethanolamine + DG(15:0/16:1(9Z)/0:0) → Cytidine monophosphate + PE(15:0/16:1(9Z)) details
CDP-Ethanolamine + DG(15:0/18:0/0:0) → Cytidine monophosphate + PE(15:0/18:0) details
CDP-Ethanolamine + DG(15:0/18:1(11Z)/0:0) → Cytidine monophosphate + PE(15:0/18:1(11Z)) details
CDP-Ethanolamine + DG(15:0/18:1(9Z)/0:0) → Cytidine monophosphate + PE(15:0/18:1(9Z)) details
CDP-Ethanolamine + DG(15:0/18:2(9Z,12Z)/0:0) → Cytidine monophosphate + PE(15:0/18:2(9Z,12Z)) details
CDP-Ethanolamine + DG(15:0/18:3(6Z,9Z,12Z)/0:0) → Cytidine monophosphate + PE(15:0/18:3(6Z,9Z,12Z)) details
CDP-Ethanolamine + DG(15:0/18:3(9Z,12Z,15Z)/0:0) → Cytidine monophosphate + PE(15:0/18:3(9Z,12Z,15Z)) details
CDP-Ethanolamine + DG(15:0/18:4(6Z,9Z,12Z,15Z)/0:0) → Cytidine monophosphate + PE(15:0/18:4(6Z,9Z,12Z,15Z)) details
CDP-Ethanolamine + DG(15:0/20:0/0:0) → Cytidine monophosphate + PE(15:0/20:0) details
CDP-Ethanolamine + DG(15:0/20:1(11Z)/0:0) → Cytidine monophosphate + PE(15:0/20:1(11Z)) details
CDP-Ethanolamine + DG(15:0/20:2(11Z,14Z)/0:0) → Cytidine monophosphate + PE(15:0/20:2(11Z,14Z)) details
CDP-Ethanolamine + DG(15:0/20:3(5Z,8Z,11Z)/0:0) → Cytidine monophosphate + PE(15:0/20:3(5Z,8Z,11Z)) details
CDP-Ethanolamine + DG(15:0/20:3(8Z,11Z,14Z)/0:0) → Cytidine monophosphate + PE(15:0/20:3(8Z,11Z,14Z)) details
CDP-Ethanolamine + DG(15:0/20:4(5Z,8Z,11Z,14Z)/0:0) → Cytidine monophosphate + PE(15:0/20:4(5Z,8Z,11Z,14Z)) details
CDP-Ethanolamine + DG(15:0/20:4(8Z,11Z,14Z,17Z)/0:0) → Cytidine monophosphate + PE(15:0/20:4(8Z,11Z,14Z,17Z)) details
CDP-Ethanolamine + DG(15:0/20:5(5Z,8Z,11Z,14Z,17Z)/0:0) → Cytidine monophosphate + PE(15:0/20:5(5Z,8Z,11Z,14Z,17Z)) details
CDP-Ethanolamine + DG(15:0/22:0/0:0) → Cytidine monophosphate + PE(15:0/22:0) details
CDP-Ethanolamine + DG(15:0/22:1(13Z)/0:0) → Cytidine monophosphate + PE(15:0/22:1(13Z)) details
CDP-Ethanolamine + DG(15:0/22:2(13Z,16Z)/0:0) → Cytidine monophosphate + PE(15:0/22:2(13Z,16Z)) details
CDP-Ethanolamine + DG(15:0/22:4(7Z,10Z,13Z,16Z)/0:0) → Cytidine monophosphate + PE(15:0/22:4(7Z,10Z,13Z,16Z)) details
CDP-Ethanolamine + DG(15:0/22:5(4Z,7Z,10Z,13Z,16Z)/0:0) → Cytidine monophosphate + PE(15:0/22:5(4Z,7Z,10Z,13Z,16Z)) details
CDP-Ethanolamine + DG(15:0/22:5(7Z,10Z,13Z,16Z,19Z)/0:0) → Cytidine monophosphate + PE(15:0/22:5(7Z,10Z,13Z,16Z,19Z)) details
CDP-Ethanolamine + DG(15:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/0:0) → Cytidine monophosphate + PE(15:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)) details
CDP-Ethanolamine + DG(15:0/24:0/0:0) → Cytidine monophosphate + PE(15:0/24:0) details
CDP-Ethanolamine + DG(15:0/24:1(15Z)/0:0) → Cytidine monophosphate + PE(15:0/24:1(15Z)) details
CDP-Ethanolamine + DG(16:0/16:1(9Z)/0:0) → Cytidine monophosphate + PE(16:0/16:1(9Z)) details
CDP-Ethanolamine + DG(16:0/18:0/0:0) → Cytidine monophosphate + PE(16:0/18:0) details
CDP-Ethanolamine + DG(16:0/18:1(11Z)/0:0) → Cytidine monophosphate + PE(16:0/18:1(11Z)) details
CDP-Ethanolamine + DG(16:0/18:1(9Z)/0:0) → Cytidine monophosphate + PE(16:0/18:1(9Z)) details
CDP-Ethanolamine + DG(16:0/18:2(9Z,12Z)/0:0) → Cytidine monophosphate + PE(16:0/18:2(9Z,12Z)) details
CDP-Ethanolamine + DG(16:0/18:3(6Z,9Z,12Z)/0:0) → Cytidine monophosphate + PE(16:0/18:3(6Z,9Z,12Z)) details
CDP-Ethanolamine + DG(16:0/18:3(9Z,12Z,15Z)/0:0) → Cytidine monophosphate + PE(16:0/18:3(9Z,12Z,15Z)) details
CDP-Ethanolamine + DG(16:0/18:4(6Z,9Z,12Z,15Z)/0:0) → Cytidine monophosphate + PE(16:0/18:4(6Z,9Z,12Z,15Z)) details
CDP-Ethanolamine + DG(16:0/20:0/0:0) → Cytidine monophosphate + PE(16:0/20:0) details
CDP-Ethanolamine + DG(16:0/20:1(11Z)/0:0) → Cytidine monophosphate + PE(16:0/20:1(11Z)) details
CDP-Ethanolamine + DG(16:0/20:2(11Z,14Z)/0:0) → Cytidine monophosphate + PE(16:0/20:2(11Z,14Z)) details
CDP-Ethanolamine + DG(16:0/20:3(5Z,8Z,11Z)/0:0) → Cytidine monophosphate + PE(16:0/20:3(5Z,8Z,11Z)) details
CDP-Ethanolamine + DG(16:0/20:3(8Z,11Z,14Z)/0:0) → Cytidine monophosphate + PE(16:0/20:3(8Z,11Z,14Z)) details
CDP-Ethanolamine + DG(16:0/20:4(5Z,8Z,11Z,14Z)/0:0) → Cytidine monophosphate + PE(16:0/20:4(5Z,8Z,11Z,14Z)) details
CDP-Ethanolamine + DG(16:0/20:5(5Z,8Z,11Z,14Z,17Z)/0:0) → Cytidine monophosphate + PE(16:0/20:5(5Z,8Z,11Z,14Z,17Z)) details
CDP-Ethanolamine + DG(16:0/22:0/0:0) → Cytidine monophosphate + PE(16:0/22:0) details
CDP-Ethanolamine + DG(16:0/22:1(13Z)/0:0) → Cytidine monophosphate + PE(16:0/22:1(13Z)) details
CDP-Ethanolamine + DG(16:0/22:2(13Z,16Z)/0:0) → Cytidine monophosphate + PE(16:0/22:2(13Z,16Z)) details
CDP-Ethanolamine + DG(16:0/22:4(7Z,10Z,13Z,16Z)/0:0) → Cytidine monophosphate + PE(16:0/22:4(7Z,10Z,13Z,16Z)) details
CDP-Ethanolamine + DG(16:0/22:5(4Z,7Z,10Z,13Z,16Z)/0:0) → Cytidine monophosphate + PE(16:0/22:5(4Z,7Z,10Z,13Z,16Z)) details
CDP-Ethanolamine + DG(16:0/22:5(7Z,10Z,13Z,16Z,19Z)/0:0) → Cytidine monophosphate + PE(16:0/22:5(7Z,10Z,13Z,16Z,19Z)) details
CDP-Ethanolamine + DG(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/0:0) → Cytidine monophosphate + PE(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)) details
CDP-Ethanolamine + DG(16:0/24:0/0:0) → Cytidine monophosphate + PE(16:0/24:0) details
CDP-Ethanolamine + DG(16:0/24:1(15Z)/0:0) → Cytidine monophosphate + PE(16:0/24:1(15Z)) details
CDP-Ethanolamine + DG(16:1(9Z)/16:1(9Z)/0:0) → Cytidine monophosphate + PE(16:1(9Z)/16:1(9Z)) details
CDP-Ethanolamine + DG(16:1(9Z)/18:0/0:0) → Cytidine monophosphate + PE(16:1(9Z)/18:0) details
CDP-Ethanolamine + DG(16:1(9Z)/18:1(11Z)/0:0) → Cytidine monophosphate + PE(16:1(9Z)/18:1(11Z)) details
CDP-Ethanolamine + DG(16:1(9Z)/18:1(9Z)/0:0) → Cytidine monophosphate + PE(16:1(9Z)/18:1(9Z)) details
CDP-Ethanolamine + DG(16:1(9Z)/18:2(9Z,12Z)/0:0) → Cytidine monophosphate + PE(16:1(9Z)/18:2(9Z,12Z)) details
CDP-Ethanolamine + DG(16:1(9Z)/18:3(6Z,9Z,12Z)/0:0) → Cytidine monophosphate + PE(16:1(9Z)/18:3(6Z,9Z,12Z)) details
CDP-Ethanolamine + DG(16:1(9Z)/18:3(9Z,12Z,15Z)/0:0) → Cytidine monophosphate + PE(16:1(9Z)/18:3(9Z,12Z,15Z)) details
CDP-Ethanolamine + DG(16:1(9Z)/18:4(6Z,9Z,12Z,15Z)/0:0) → Cytidine monophosphate + PE(16:1(9Z)/18:4(6Z,9Z,12Z,15Z)) details
CDP-Ethanolamine + DG(16:1(9Z)/20:0/0:0) → Cytidine monophosphate + PE(16:1(9Z)/20:0) details
CDP-Ethanolamine + DG(16:1(9Z)/20:1(11Z)/0:0) → Cytidine monophosphate + PE(16:1(9Z)/20:1(11Z)) details
CDP-Ethanolamine + DG(16:1(9Z)/20:2(11Z,14Z)/0:0) → Cytidine monophosphate + PE(16:1(9Z)/20:2(11Z,14Z)) details
CDP-Ethanolamine + DG(16:1(9Z)/20:3(5Z,8Z,11Z)/0:0) → Cytidine monophosphate + PE(16:1(9Z)/20:3(5Z,8Z,11Z)) details
CDP-Ethanolamine + DG(16:1(9Z)/20:3(8Z,11Z,14Z)/0:0) → Cytidine monophosphate + PE(16:1(9Z)/20:3(8Z,11Z,14Z)) details
CDP-Ethanolamine + DG(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)/0:0) → Cytidine monophosphate + PE(16:1(9Z)/20:4(5Z,8Z,11Z,14Z)) details
CDP-Ethanolamine + DG(16:1(9Z)/20:4(8Z,11Z,14Z,17Z)/0:0) → Cytidine monophosphate + PE(16:1(9Z)/20:4(8Z,11Z,14Z,17Z)) details
CDP-Ethanolamine + DG(16:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z)/0:0) → Cytidine monophosphate + PE(16:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z)) details
CDP-Ethanolamine + DG(16:1(9Z)/22:0/0:0) → Cytidine monophosphate + PE(16:1(9Z)/22:0) details
CDP-Ethanolamine + DG(16:1(9Z)/22:1(13Z)/0:0) → Cytidine monophosphate + PE(16:1(9Z)/22:1(13Z)) details
CDP-Ethanolamine + DG(16:1(9Z)/22:2(13Z,16Z)/0:0) → Cytidine monophosphate + PE(16:1(9Z)/22:2(13Z,16Z)) details
CDP-Ethanolamine + DG(16:1(9Z)/22:4(7Z,10Z,13Z,16Z)/0:0) → Cytidine monophosphate + PE(16:1(9Z)/22:4(7Z,10Z,13Z,16Z)) details
CDP-Ethanolamine + DG(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/0:0) → Cytidine monophosphate + PE(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)) details
CDP-Ethanolamine + DG(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/0:0) → Cytidine monophosphate + PE(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)) details
CDP-Ethanolamine + DG(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/0:0) → Cytidine monophosphate + PE(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)) details
CDP-Ethanolamine + DG(16:1(9Z)/24:0/0:0) → Cytidine monophosphate + PE(16:1(9Z)/24:0) details
CDP-Ethanolamine + DG(16:1(9Z)/24:1(15Z)/0:0) → Cytidine monophosphate + PE(16:1(9Z)/24:1(15Z)) details
CDP-Ethanolamine + DG(18:0/18:0/0:0) → Cytidine monophosphate + PE(18:0/18:0) details
CDP-Ethanolamine + DG(18:0/18:1(11Z)/0:0) → Cytidine monophosphate + PE(18:0/18:1(11Z)) details
CDP-Ethanolamine + DG(18:0/18:1(9Z)/0:0) → Cytidine monophosphate + PE(18:0/18:1(9Z)) details
CDP-Ethanolamine + DG(18:0/18:2(9Z,12Z)/0:0) → Cytidine monophosphate + PE(18:0/18:2(9Z,12Z)) details
CDP-Ethanolamine + DG(18:0/18:3(6Z,9Z,12Z)/0:0) → Cytidine monophosphate + PE(18:0/18:3(6Z,9Z,12Z)) details
CDP-Ethanolamine + DG(18:0/18:3(9Z,12Z,15Z)/0:0) → Cytidine monophosphate + PE(18:0/18:3(9Z,12Z,15Z)) details
CDP-Ethanolamine + DG(18:0/18:4(6Z,9Z,12Z,15Z)/0:0) → Cytidine monophosphate + PE(18:0/18:4(6Z,9Z,12Z,15Z)) details
CDP-Ethanolamine + DG(18:0/20:0/0:0) → Cytidine monophosphate + PE(18:0/20:0) details
CDP-Ethanolamine + DG(18:0/20:1(11Z)/0:0) → Cytidine monophosphate + PE(18:0/20:1(11Z)) details
CDP-Ethanolamine + DG(18:0/20:2(11Z,14Z)/0:0) → Cytidine monophosphate + PE(18:0/20:2(11Z,14Z)) details
CDP-Ethanolamine + DG(18:0/20:3(5Z,8Z,11Z)/0:0) → Cytidine monophosphate + PE(18:0/20:3(5Z,8Z,11Z)) details
CDP-Ethanolamine + DG(18:0/20:3(8Z,11Z,14Z)/0:0) → Cytidine monophosphate + PE(18:0/20:3(8Z,11Z,14Z)) details
CDP-Ethanolamine + DG(18:0/20:4(5Z,8Z,11Z,14Z)/0:0) → Cytidine monophosphate + PE(18:0/20:4(5Z,8Z,11Z,14Z)) details
CDP-Ethanolamine + DG(18:0/20:4(8Z,11Z,14Z,17Z)/0:0) → Cytidine monophosphate + PE(18:0/20:4(8Z,11Z,14Z,17Z)) details
CDP-Ethanolamine + DG(18:0/20:5(5Z,8Z,11Z,14Z,17Z)/0:0) → Cytidine monophosphate + PE(18:0/20:5(5Z,8Z,11Z,14Z,17Z)) details
CDP-Ethanolamine + DG(18:0/22:0/0:0) → Cytidine monophosphate + PE(18:0/22:0) details
CDP-Ethanolamine + DG(18:0/22:1(13Z)/0:0) → Cytidine monophosphate + PE(18:0/22:1(13Z)) details
CDP-Ethanolamine + DG(18:0/22:2(13Z,16Z)/0:0) → Cytidine monophosphate + PE(18:0/22:2(13Z,16Z)) details
CDP-Ethanolamine + DG(18:0/22:4(7Z,10Z,13Z,16Z)/0:0) → Cytidine monophosphate + PE(18:0/22:4(7Z,10Z,13Z,16Z)) details
CDP-Ethanolamine + DG(18:0/22:5(4Z,7Z,10Z,13Z,16Z)/0:0) → Cytidine monophosphate + PE(18:0/22:5(4Z,7Z,10Z,13Z,16Z)) details
CDP-Ethanolamine + DG(18:0/22:5(7Z,10Z,13Z,16Z,19Z)/0:0) → Cytidine monophosphate + PE(18:0/22:5(7Z,10Z,13Z,16Z,19Z)) details
CDP-Ethanolamine + DG(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/0:0) → Cytidine monophosphate + PE(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)) details
CDP-Ethanolamine + DG(18:0/24:0/0:0) → Cytidine monophosphate + PE(18:0/24:0) details
CDP-Ethanolamine + DG(18:0/24:1(15Z)/0:0) → Cytidine monophosphate + PE(18:0/24:1(15Z)) details
CDP-Ethanolamine + DG(18:1(11Z)/18:1(11Z)/0:0) → Cytidine monophosphate + PE(18:1(11Z)/18:1(11Z)) details
CDP-Ethanolamine + DG(18:1(11Z)/18:1(9Z)/0:0) → Cytidine monophosphate + PE(18:1(11Z)/18:1(9Z)) details
CDP-Ethanolamine + DG(18:1(11Z)/18:2(9Z,12Z)/0:0) → Cytidine monophosphate + PE(18:1(11Z)/18:2(9Z,12Z)) details
CDP-Ethanolamine + DG(18:1(11Z)/18:3(6Z,9Z,12Z)/0:0) → Cytidine monophosphate + PE(18:1(11Z)/18:3(6Z,9Z,12Z)) details
CDP-Ethanolamine + DG(18:1(11Z)/18:3(9Z,12Z,15Z)/0:0) → Cytidine monophosphate + PE(18:1(11Z)/18:3(9Z,12Z,15Z)) details
CDP-Ethanolamine + DG(18:1(11Z)/18:4(6Z,9Z,12Z,15Z)/0:0) → Cytidine monophosphate + PE(18:1(11Z)/18:4(6Z,9Z,12Z,15Z)) details
CDP-Ethanolamine + DG(18:1(11Z)/20:0/0:0) → Cytidine monophosphate + PE(18:1(11Z)/20:0) details
CDP-Ethanolamine + DG(18:1(11Z)/20:1(11Z)/0:0) → Cytidine monophosphate + PE(18:1(11Z)/20:1(11Z)) details
CDP-Ethanolamine + DG(18:1(11Z)/20:2(11Z,14Z)/0:0) → Cytidine monophosphate + PE(18:1(11Z)/20:2(11Z,14Z)) details
CDP-Ethanolamine + DG(18:1(11Z)/20:3(5Z,8Z,11Z)/0:0) → Cytidine monophosphate + PE(18:1(11Z)/20:3(5Z,8Z,11Z)) details
CDP-Ethanolamine + DG(18:1(11Z)/20:3(8Z,11Z,14Z)/0:0) → Cytidine monophosphate + PE(18:1(11Z)/20:3(8Z,11Z,14Z)) details
CDP-Ethanolamine + DG(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)/0:0) → Cytidine monophosphate + PE(18:1(11Z)/20:4(5Z,8Z,11Z,14Z)) details
CDP-Ethanolamine + DG(18:1(11Z)/20:4(8Z,11Z,14Z,17Z)/0:0) → Cytidine monophosphate + PE(18:1(11Z)/20:4(8Z,11Z,14Z,17Z)) details
CDP-Ethanolamine + DG(18:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z)/0:0) → Cytidine monophosphate + PE(18:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z)) details
CDP-Ethanolamine + DG(18:1(11Z)/22:0/0:0) → Cytidine monophosphate + PE(18:1(11Z)/22:0) details
CDP-Ethanolamine + DG(18:1(11Z)/22:1(13Z)/0:0) → Cytidine monophosphate + PE(18:1(11Z)/22:1(13Z)) details
CDP-Ethanolamine + DG(18:1(11Z)/22:2(13Z,16Z)/0:0) → Cytidine monophosphate + PE(18:1(11Z)/22:2(13Z,16Z)) details
CDP-Ethanolamine + DG(18:1(11Z)/22:4(7Z,10Z,13Z,16Z)/0:0) → Cytidine monophosphate + PE(18:1(11Z)/22:4(7Z,10Z,13Z,16Z)) details
CDP-Ethanolamine + DG(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/0:0) → Cytidine monophosphate + PE(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)) details
CDP-Ethanolamine + DG(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/0:0) → Cytidine monophosphate + PE(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)) details
CDP-Ethanolamine + DG(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/0:0) → Cytidine monophosphate + PE(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)) details
CDP-Ethanolamine + DG(18:1(11Z)/24:0/0:0) → Cytidine monophosphate + PE(18:1(11Z)/24:0) details
CDP-Ethanolamine + DG(18:1(11Z)/24:1(15Z)/0:0) → Cytidine monophosphate + PE(18:1(11Z)/24:1(15Z)) details
CDP-Ethanolamine + DG(18:1(9Z)/18:1(9Z)/0:0) → Cytidine monophosphate + PE(18:1(9Z)/18:1(9Z)) details
CDP-Ethanolamine + DG(18:1(9Z)/18:2(9Z,12Z)/0:0) → Cytidine monophosphate + PE(18:1(9Z)/18:2(9Z,12Z)) details
CDP-Ethanolamine + DG(18:1(9Z)/18:3(6Z,9Z,12Z)/0:0) → Cytidine monophosphate + PE(18:1(9Z)/18:3(6Z,9Z,12Z)) details
CDP-Ethanolamine + DG(18:1(9Z)/18:3(9Z,12Z,15Z)/0:0) → Cytidine monophosphate + PE(18:1(9Z)/18:3(9Z,12Z,15Z)) details
CDP-Ethanolamine + DG(18:1(9Z)/18:4(6Z,9Z,12Z,15Z)/0:0) → Cytidine monophosphate + PE(18:1(9Z)/18:4(6Z,9Z,12Z,15Z)) details
CDP-Ethanolamine + DG(18:1(9Z)/20:0/0:0) → Cytidine monophosphate + PE(18:1(9Z)/20:0) details
CDP-Ethanolamine + DG(18:1(9Z)/20:1(11Z)/0:0) → Cytidine monophosphate + PE(18:1(9Z)/20:1(11Z)) details
CDP-Ethanolamine + DG(18:1(9Z)/20:2(11Z,14Z)/0:0) → Cytidine monophosphate + PE(18:1(9Z)/20:2(11Z,14Z)) details
CDP-Ethanolamine + DG(18:1(9Z)/20:3(5Z,8Z,11Z)/0:0) → Cytidine monophosphate + PE(18:1(9Z)/20:3(5Z,8Z,11Z)) details
CDP-Ethanolamine + DG(18:1(9Z)/20:3(8Z,11Z,14Z)/0:0) → Cytidine monophosphate + PE(18:1(9Z)/20:3(8Z,11Z,14Z)) details
CDP-Ethanolamine + DG(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)/0:0) → Cytidine monophosphate + PE(18:1(9Z)/20:4(5Z,8Z,11Z,14Z)) details
CDP-Ethanolamine + DG(18:1(9Z)/20:4(8Z,11Z,14Z,17Z)/0:0) → Cytidine monophosphate + PE(18:1(9Z)/20:4(8Z,11Z,14Z,17Z)) details
CDP-Ethanolamine + DG(18:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z)/0:0) → Cytidine monophosphate + PE(18:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z)) details
CDP-Ethanolamine + DG(18:1(9Z)/22:0/0:0) → Cytidine monophosphate + PE(18:1(9Z)/22:0) details
CDP-Ethanolamine + DG(18:1(9Z)/22:1(13Z)/0:0) → Cytidine monophosphate + PE(18:1(9Z)/22:1(13Z)) details
CDP-Ethanolamine + DG(18:1(9Z)/22:2(13Z,16Z)/0:0) → Cytidine monophosphate + PE(18:1(9Z)/22:2(13Z,16Z)) details
CDP-Ethanolamine + DG(18:1(9Z)/22:4(7Z,10Z,13Z,16Z)/0:0) → Cytidine monophosphate + PE(18:1(9Z)/22:4(7Z,10Z,13Z,16Z)) details
CDP-Ethanolamine + DG(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)/0:0) → Cytidine monophosphate + PE(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z)) details
CDP-Ethanolamine + DG(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)/0:0) → Cytidine monophosphate + PE(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z)) details
CDP-Ethanolamine + DG(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/0:0) → Cytidine monophosphate + PE(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)) details
CDP-Ethanolamine + DG(18:1(9Z)/24:0/0:0) → Cytidine monophosphate + PE(18:1(9Z)/24:0) details
CDP-Ethanolamine + DG(18:1(9Z)/24:1(15Z)/0:0) → Cytidine monophosphate + PE(18:1(9Z)/24:1(15Z)) details
CDP-Ethanolamine + DG(18:2(9Z,12Z)/18:2(9Z,12Z)/0:0) → Cytidine monophosphate + PE(18:2(9Z,12Z)/18:2(9Z,12Z)) details
CDP-Ethanolamine + DG(18:2(9Z,12Z)/18:3(6Z,9Z,12Z)/0:0) → Cytidine monophosphate + PE(18:2(9Z,12Z)/18:3(6Z,9Z,12Z)) details
CDP-Ethanolamine + DG(18:2(9Z,12Z)/18:3(9Z,12Z,15Z)/0:0) → Cytidine monophosphate + PE(18:2(9Z,12Z)/18:3(9Z,12Z,15Z)) details
CDP-Ethanolamine + DG(18:2(9Z,12Z)/18:4(6Z,9Z,12Z,15Z)/0:0) → Cytidine monophosphate + PE(18:2(9Z,12Z)/18:4(6Z,9Z,12Z,15Z)) details
CDP-Ethanolamine + DG(18:2(9Z,12Z)/20:0/0:0) → Cytidine monophosphate + PE(18:2(9Z,12Z)/20:0) details
CDP-Ethanolamine + DG(18:2(9Z,12Z)/20:1(11Z)/0:0) → Cytidine monophosphate + PE(18:2(9Z,12Z)/20:1(11Z)) details
CDP-Ethanolamine + DG(18:2(9Z,12Z)/20:2(11Z,14Z)/0:0) → Cytidine monophosphate + PE(18:2(9Z,12Z)/20:2(11Z,14Z)) details
CDP-Ethanolamine + DG(18:2(9Z,12Z)/20:3(5Z,8Z,11Z)/0:0) → Cytidine monophosphate + PE(18:2(9Z,12Z)/20:3(5Z,8Z,11Z)) details
CDP-Ethanolamine + DG(18:2(9Z,12Z)/20:3(8Z,11Z,14Z)/0:0) → Cytidine monophosphate + PE(18:2(9Z,12Z)/20:3(8Z,11Z,14Z)) details
CDP-Ethanolamine + DG(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/0:0) → Cytidine monophosphate + PE(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z)) details
CDP-Ethanolamine + DG(18:2(9Z,12Z)/20:4(8Z,11Z,14Z,17Z)/0:0) → Cytidine monophosphate + PE(18:2(9Z,12Z)/20:4(8Z,11Z,14Z,17Z)) details
CDP-Ethanolamine + DG(18:2(9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z)/0:0) → Cytidine monophosphate + PE(18:2(9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z)) details
CDP-Ethanolamine + DG(18:2(9Z,12Z)/22:0/0:0) → Cytidine monophosphate + PE(18:2(9Z,12Z)/22:0) details
CDP-Ethanolamine + DG(18:2(9Z,12Z)/22:1(13Z)/0:0) → Cytidine monophosphate + PE(18:2(9Z,12Z)/22:1(13Z)) details
CDP-Ethanolamine + DG(18:2(9Z,12Z)/22:2(13Z,16Z)/0:0) → Cytidine monophosphate + PE(18:2(9Z,12Z)/22:2(13Z,16Z)) details
CDP-Ethanolamine + DG(18:2(9Z,12Z)/22:4(7Z,10Z,13Z,16Z)/0:0) → Cytidine monophosphate + PE(18:2(9Z,12Z)/22:4(7Z,10Z,13Z,16Z)) details
CDP-Ethanolamine + DG(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/0:0) → Cytidine monophosphate + PE(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)) details
CDP-Ethanolamine + DG(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/0:0) → Cytidine monophosphate + PE(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)) details
CDP-Ethanolamine + DG(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/0:0) → Cytidine monophosphate + PE(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)) details
CDP-Ethanolamine + DG(18:2(9Z,12Z)/24:0/0:0) → Cytidine monophosphate + PE(18:2(9Z,12Z)/24:0) details
CDP-Ethanolamine + DG(18:2(9Z,12Z)/24:1(15Z)/0:0) → Cytidine monophosphate + PE(18:2(9Z,12Z)/24:1(15Z)) details
CDP-Ethanolamine + DG(18:3(6Z,9Z,12Z)/18:3(6Z,9Z,12Z)/0:0) → Cytidine monophosphate + PE(18:3(6Z,9Z,12Z)/18:3(6Z,9Z,12Z)) details
CDP-Ethanolamine + DG(18:3(6Z,9Z,12Z)/18:3(9Z,12Z,15Z)/0:0) → Cytidine monophosphate + PE(18:3(6Z,9Z,12Z)/18:3(9Z,12Z,15Z)) details
CDP-Ethanolamine + DG(18:3(6Z,9Z,12Z)/18:4(6Z,9Z,12Z,15Z)/0:0) → Cytidine monophosphate + PE(18:3(6Z,9Z,12Z)/18:4(6Z,9Z,12Z,15Z)) details
CDP-Ethanolamine + DG(18:3(6Z,9Z,12Z)/20:0/0:0) → Cytidine monophosphate + PE(18:3(6Z,9Z,12Z)/20:0) details
CDP-Ethanolamine + DG(18:3(6Z,9Z,12Z)/20:1(11Z)/0:0) → Cytidine monophosphate + PE(18:3(6Z,9Z,12Z)/20:1(11Z)) details
CDP-Ethanolamine + DG(18:3(6Z,9Z,12Z)/20:2(11Z,14Z)/0:0) → Cytidine monophosphate + PE(18:3(6Z,9Z,12Z)/20:2(11Z,14Z)) details
CDP-Ethanolamine + DG(18:3(6Z,9Z,12Z)/20:3(5Z,8Z,11Z)/0:0) → Cytidine monophosphate + PE(18:3(6Z,9Z,12Z)/20:3(5Z,8Z,11Z)) details
CDP-Ethanolamine + DG(18:3(6Z,9Z,12Z)/20:3(8Z,11Z,14Z)/0:0) → Cytidine monophosphate + PE(18:3(6Z,9Z,12Z)/20:3(8Z,11Z,14Z)) details
CDP-Ethanolamine + DG(18:3(6Z,9Z,12Z)/20:4(5Z,8Z,11Z,14Z)/0:0) → Cytidine monophosphate + PE(18:3(6Z,9Z,12Z)/20:4(5Z,8Z,11Z,14Z)) details
CDP-Ethanolamine + DG(18:3(6Z,9Z,12Z)/20:4(8Z,11Z,14Z,17Z)/0:0) → Cytidine monophosphate + PE(18:3(6Z,9Z,12Z)/20:4(8Z,11Z,14Z,17Z)) details
CDP-Ethanolamine + DG(18:3(6Z,9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z)/0:0) → Cytidine monophosphate + PE(18:3(6Z,9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z)) details
CDP-Ethanolamine + DG(18:3(6Z,9Z,12Z)/22:0/0:0) → Cytidine monophosphate + PE(18:3(6Z,9Z,12Z)/22:0) details
CDP-Ethanolamine + DG(18:3(6Z,9Z,12Z)/22:1(13Z)/0:0) → Cytidine monophosphate + PE(18:3(6Z,9Z,12Z)/22:1(13Z)) details
CDP-Ethanolamine + DG(18:3(6Z,9Z,12Z)/22:2(13Z,16Z)/0:0) → Cytidine monophosphate + PE(18:3(6Z,9Z,12Z)/22:2(13Z,16Z)) details
CDP-Ethanolamine + DG(18:3(6Z,9Z,12Z)/22:4(7Z,10Z,13Z,16Z)/0:0) → Cytidine monophosphate + PE(18:3(6Z,9Z,12Z)/22:4(7Z,10Z,13Z,16Z)) details
CDP-Ethanolamine + DG(18:3(6Z,9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)/0:0) → Cytidine monophosphate + PE(18:3(6Z,9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z)) details
CDP-Ethanolamine + DG(18:3(6Z,9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)/0:0) → Cytidine monophosphate + PE(18:3(6Z,9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z)) details
CDP-Ethanolamine + DG(18:3(6Z,9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/0:0) → Cytidine monophosphate + PE(18:3(6Z,9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)) details
CDP-Ethanolamine + DG(18:3(6Z,9Z,12Z)/24:0/0:0) → Cytidine monophosphate + PE(18:3(6Z,9Z,12Z)/24:0) details
CDP-Ethanolamine + DG(18:3(6Z,9Z,12Z)/24:1(15Z)/0:0) → Cytidine monophosphate + PE(18:3(6Z,9Z,12Z)/24:1(15Z)) details
CDP-Ethanolamine + DG(18:3(9Z,12Z,15Z)/18:3(9Z,12Z,15Z)/0:0) → Cytidine monophosphate + PE(18:3(9Z,12Z,15Z)/18:3(9Z,12Z,15Z)) details
CDP-Ethanolamine + DG(18:3(9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z)/0:0) → Cytidine monophosphate + PE(18:3(9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z)) details
CDP-Ethanolamine + DG(18:3(9Z,12Z,15Z)/20:0/0:0) → Cytidine monophosphate + PE(18:3(9Z,12Z,15Z)/20:0) details
CDP-Ethanolamine + DG(18:3(9Z,12Z,15Z)/20:1(11Z)/0:0) → Cytidine monophosphate + PE(18:3(9Z,12Z,15Z)/20:1(11Z)) details
CDP-Ethanolamine + DG(18:3(9Z,12Z,15Z)/20:2(11Z,14Z)/0:0) → Cytidine monophosphate + PE(18:3(9Z,12Z,15Z)/20:2(11Z,14Z)) details
CDP-Ethanolamine + DG(18:3(9Z,12Z,15Z)/20:3(5Z,8Z,11Z)/0:0) → Cytidine monophosphate + PE(18:3(9Z,12Z,15Z)/20:3(5Z,8Z,11Z)) details
CDP-Ethanolamine + DG(18:3(9Z,12Z,15Z)/20:3(8Z,11Z,14Z)/0:0) → Cytidine monophosphate + PE(18:3(9Z,12Z,15Z)/20:3(8Z,11Z,14Z)) details
CDP-Ethanolamine + DG(18:3(9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z)/0:0) → Cytidine monophosphate + PE(18:3(9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z)) details
CDP-Ethanolamine + DG(18:3(9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z)/0:0) → Cytidine monophosphate + PE(18:3(9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z)) details
CDP-Ethanolamine + DG(18:3(9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z)/0:0) → Cytidine monophosphate + PE(18:3(9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z)) details
CDP-Ethanolamine + DG(18:3(9Z,12Z,15Z)/22:0/0:0) → Cytidine monophosphate + PE(18:3(9Z,12Z,15Z)/22:0) details
CDP-Ethanolamine + DG(18:3(9Z,12Z,15Z)/22:1(13Z)/0:0) → Cytidine monophosphate + PE(18:3(9Z,12Z,15Z)/22:1(13Z)) details
CDP-Ethanolamine + DG(18:3(9Z,12Z,15Z)/22:2(13Z,16Z)/0:0) → Cytidine monophosphate + PE(18:3(9Z,12Z,15Z)/22:2(13Z,16Z)) details
CDP-Ethanolamine + DG(18:3(9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z)/0:0) → Cytidine monophosphate + PE(18:3(9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z)) details
CDP-Ethanolamine + DG(18:3(9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z)/0:0) → Cytidine monophosphate + PE(18:3(9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z)) details
CDP-Ethanolamine + DG(18:3(9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z)/0:0) → Cytidine monophosphate + PE(18:3(9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z)) details
CDP-Ethanolamine + DG(18:3(9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/0:0) → Cytidine monophosphate + PE(18:3(9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)) details
CDP-Ethanolamine + DG(18:3(9Z,12Z,15Z)/24:0/0:0) → Cytidine monophosphate + PE(18:3(9Z,12Z,15Z)/24:0) details
CDP-Ethanolamine + DG(18:3(9Z,12Z,15Z)/24:1(15Z)/0:0) → Cytidine monophosphate + PE(18:3(9Z,12Z,15Z)/24:1(15Z)) details
CDP-Ethanolamine + DG(18:4(6Z,9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z)/0:0) → Cytidine monophosphate + PE(18:4(6Z,9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z)) details
CDP-Ethanolamine + DG(18:4(6Z,9Z,12Z,15Z)/20:0/0:0) → Cytidine monophosphate + PE(18:4(6Z,9Z,12Z,15Z)/20:0) details
CDP-Ethanolamine + DG(18:4(6Z,9Z,12Z,15Z)/20:1(11Z)/0:0) → Cytidine monophosphate + PE(18:4(6Z,9Z,12Z,15Z)/20:1(11Z)) details
CDP-Ethanolamine + DG(18:4(6Z,9Z,12Z,15Z)/20:2(11Z,14Z)/0:0) → Cytidine monophosphate + PE(18:4(6Z,9Z,12Z,15Z)/20:2(11Z,14Z)) details
CDP-Ethanolamine + DG(18:4(6Z,9Z,12Z,15Z)/20:3(5Z,8Z,11Z)/0:0) → Cytidine monophosphate + PE(18:4(6Z,9Z,12Z,15Z)/20:3(5Z,8Z,11Z)) details
CDP-Ethanolamine + DG(18:4(6Z,9Z,12Z,15Z)/20:3(8Z,11Z,14Z)/0:0) → Cytidine monophosphate + PE(18:4(6Z,9Z,12Z,15Z)/20:3(8Z,11Z,14Z)) details
CDP-Ethanolamine + DG(18:4(6Z,9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z)/0:0) → Cytidine monophosphate + PE(18:4(6Z,9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z)) details
CDP-Ethanolamine + DG(18:4(6Z,9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z)/0:0) → Cytidine monophosphate + PE(18:4(6Z,9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z)) details
CDP-Ethanolamine + DG(18:4(6Z,9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z)/0:0) → Cytidine monophosphate + PE(18:4(6Z,9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z)) details
CDP-Ethanolamine + DG(18:4(6Z,9Z,12Z,15Z)/22:0/0:0) → Cytidine monophosphate + PE(18:4(6Z,9Z,12Z,15Z)/22:0) details
CDP-Ethanolamine + DG(18:4(6Z,9Z,12Z,15Z)/22:1(13Z)/0:0) → Cytidine monophosphate + PE(18:4(6Z,9Z,12Z,15Z)/22:1(13Z)) details
CDP-Ethanolamine + DG(18:4(6Z,9Z,12Z,15Z)/22:2(13Z,16Z)/0:0) → Cytidine monophosphate + PE(18:4(6Z,9Z,12Z,15Z)/22:2(13Z,16Z)) details
CDP-Ethanolamine + DG(18:4(6Z,9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z)/0:0) → Cytidine monophosphate + PE(18:4(6Z,9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z)) details
CDP-Ethanolamine + DG(18:4(6Z,9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z)/0:0) → Cytidine monophosphate + PE(18:4(6Z,9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z)) details
CDP-Ethanolamine + DG(18:4(6Z,9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z)/0:0) → Cytidine monophosphate + PE(18:4(6Z,9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z)) details
CDP-Ethanolamine + DG(18:4(6Z,9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/0:0) → Cytidine monophosphate + PE(18:4(6Z,9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)) details
CDP-Ethanolamine + DG(18:4(6Z,9Z,12Z,15Z)/24:0/0:0) → Cytidine monophosphate + PE(18:4(6Z,9Z,12Z,15Z)/24:0) details
CDP-Ethanolamine + DG(18:4(6Z,9Z,12Z,15Z)/24:1(15Z)/0:0) → Cytidine monophosphate + PE(18:4(6Z,9Z,12Z,15Z)/24:1(15Z)) details
CDP-Ethanolamine + DG(20:0/20:0/0:0) → Cytidine monophosphate + PE(20:0/20:0) details
CDP-Ethanolamine + DG(20:0/20:1(11Z)/0:0) → Cytidine monophosphate + PE(20:0/20:1(11Z)) details
CDP-Ethanolamine + DG(20:0/20:2(11Z,14Z)/0:0) → Cytidine monophosphate + PE(20:0/20:2(11Z,14Z)) details
CDP-Ethanolamine + DG(20:0/20:3(5Z,8Z,11Z)/0:0) → Cytidine monophosphate + PE(20:0/20:3(5Z,8Z,11Z)) details
CDP-Ethanolamine + DG(20:0/20:3(8Z,11Z,14Z)/0:0) → Cytidine monophosphate + PE(20:0/20:3(8Z,11Z,14Z)) details
CDP-Ethanolamine + DG(20:0/20:4(5Z,8Z,11Z,14Z)/0:0) → Cytidine monophosphate + PE(20:0/20:4(5Z,8Z,11Z,14Z)) details
CDP-Ethanolamine + DG(20:0/20:4(8Z,11Z,14Z,17Z)/0:0) → Cytidine monophosphate + PE(20:0/20:4(8Z,11Z,14Z,17Z)) details
CDP-Ethanolamine + DG(20:0/20:5(5Z,8Z,11Z,14Z,17Z)/0:0) → Cytidine monophosphate + PE(20:0/20:5(5Z,8Z,11Z,14Z,17Z)) details
CDP-Ethanolamine + DG(20:0/22:0/0:0) → Cytidine monophosphate + PE(20:0/22:0) details
CDP-Ethanolamine + DG(20:0/22:1(13Z)/0:0) → Cytidine monophosphate + PE(20:0/22:1(13Z)) details
CDP-Ethanolamine + DG(20:0/22:2(13Z,16Z)/0:0) → Cytidine monophosphate + PE(20:0/22:2(13Z,16Z)) details
CDP-Ethanolamine + DG(20:0/22:4(7Z,10Z,13Z,16Z)/0:0) → Cytidine monophosphate + PE(20:0/22:4(7Z,10Z,13Z,16Z)) details
CDP-Ethanolamine + DG(20:0/22:5(4Z,7Z,10Z,13Z,16Z)/0:0) → Cytidine monophosphate + PE(20:0/22:5(4Z,7Z,10Z,13Z,16Z)) details
CDP-Ethanolamine + DG(20:0/22:5(7Z,10Z,13Z,16Z,19Z)/0:0) → Cytidine monophosphate + PE(20:0/22:5(7Z,10Z,13Z,16Z,19Z)) details
CDP-Ethanolamine + DG(20:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/0:0) → Cytidine monophosphate + PE(20:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)) details
CDP-Ethanolamine + DG(20:0/24:0/0:0) → Cytidine monophosphate + PE(20:0/24:0) details
CDP-Ethanolamine + DG(20:0/24:1(15Z)/0:0) → Cytidine monophosphate + PE(20:0/24:1(15Z)) details
CDP-Ethanolamine + DG(20:1(11Z)/20:1(11Z)/0:0) → Cytidine monophosphate + PE(20:1(11Z)/20:1(11Z)) details
CDP-Ethanolamine + DG(20:1(11Z)/20:2(11Z,14Z)/0:0) → Cytidine monophosphate + PE(20:1(11Z)/20:2(11Z,14Z)) details
CDP-Ethanolamine + DG(20:1(11Z)/20:3(5Z,8Z,11Z)/0:0) → Cytidine monophosphate + PE(20:1(11Z)/20:3(5Z,8Z,11Z)) details
CDP-Ethanolamine + DG(20:1(11Z)/20:3(8Z,11Z,14Z)/0:0) → Cytidine monophosphate + PE(20:1(11Z)/20:3(8Z,11Z,14Z)) details
CDP-Ethanolamine + DG(20:1(11Z)/20:4(5Z,8Z,11Z,14Z)/0:0) → Cytidine monophosphate + PE(20:1(11Z)/20:4(5Z,8Z,11Z,14Z)) details
CDP-Ethanolamine + DG(20:1(11Z)/20:4(8Z,11Z,14Z,17Z)/0:0) → Cytidine monophosphate + PE(20:1(11Z)/20:4(8Z,11Z,14Z,17Z)) details
CDP-Ethanolamine + DG(20:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z)/0:0) → Cytidine monophosphate + PE(20:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z)) details
CDP-Ethanolamine + DG(20:1(11Z)/22:0/0:0) → Cytidine monophosphate + PE(20:1(11Z)/22:0) details
CDP-Ethanolamine + DG(20:1(11Z)/22:1(13Z)/0:0) → Cytidine monophosphate + PE(20:1(11Z)/22:1(13Z)) details
CDP-Ethanolamine + DG(20:1(11Z)/22:2(13Z,16Z)/0:0) → Cytidine monophosphate + PE(20:1(11Z)/22:2(13Z,16Z)) details
CDP-Ethanolamine + DG(20:1(11Z)/22:4(7Z,10Z,13Z,16Z)/0:0) → Cytidine monophosphate + PE(20:1(11Z)/22:4(7Z,10Z,13Z,16Z)) details
CDP-Ethanolamine + DG(20:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/0:0) → Cytidine monophosphate + PE(20:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z)) details
CDP-Ethanolamine + DG(20:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/0:0) → Cytidine monophosphate + PE(20:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z)) details
CDP-Ethanolamine + DG(20:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/0:0) → Cytidine monophosphate + PE(20:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)) details
CDP-Ethanolamine + DG(20:1(11Z)/24:0/0:0) → Cytidine monophosphate + PE(20:1(11Z)/24:0) details
CDP-Ethanolamine + DG(20:1(11Z)/24:1(15Z)/0:0) → Cytidine monophosphate + PE(20:1(11Z)/24:1(15Z)) details
CDP-Ethanolamine + DG(20:2(11Z,14Z)/20:2(11Z,14Z)/0:0) → Cytidine monophosphate + PE(20:2(11Z,14Z)/20:2(11Z,14Z)) details
CDP-Ethanolamine + DG(20:2(11Z,14Z)/20:3(5Z,8Z,11Z)/0:0) → Cytidine monophosphate + PE(20:2(11Z,14Z)/20:3(5Z,8Z,11Z)) details
CDP-Ethanolamine + DG(20:2(11Z,14Z)/20:3(8Z,11Z,14Z)/0:0) → Cytidine monophosphate + PE(20:2(11Z,14Z)/20:3(8Z,11Z,14Z)) details
CDP-Ethanolamine + DG(20:2(11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/0:0) → Cytidine monophosphate + PE(20:2(11Z,14Z)/20:4(5Z,8Z,11Z,14Z)) details
CDP-Ethanolamine + DG(20:2(11Z,14Z)/20:4(8Z,11Z,14Z,17Z)/0:0) → Cytidine monophosphate + PE(20:2(11Z,14Z)/20:4(8Z,11Z,14Z,17Z)) details
CDP-Ethanolamine + DG(20:2(11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z)/0:0) → Cytidine monophosphate + PE(20:2(11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z)) details
CDP-Ethanolamine + DG(20:2(11Z,14Z)/22:0/0:0) → Cytidine monophosphate + PE(20:2(11Z,14Z)/22:0) details
CDP-Ethanolamine + DG(20:2(11Z,14Z)/22:1(13Z)/0:0) → Cytidine monophosphate + PE(20:2(11Z,14Z)/22:1(13Z)) details
CDP-Ethanolamine + DG(20:2(11Z,14Z)/22:2(13Z,16Z)/0:0) → Cytidine monophosphate + PE(20:2(11Z,14Z)/22:2(13Z,16Z)) details
CDP-Ethanolamine + DG(20:2(11Z,14Z)/22:4(7Z,10Z,13Z,16Z)/0:0) → Cytidine monophosphate + PE(20:2(11Z,14Z)/22:4(7Z,10Z,13Z,16Z)) details
CDP-Ethanolamine + DG(20:2(11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/0:0) → Cytidine monophosphate + PE(20:2(11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)) details
CDP-Ethanolamine + DG(20:2(11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/0:0) → Cytidine monophosphate + PE(20:2(11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)) details
CDP-Ethanolamine + DG(20:2(11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/0:0) → Cytidine monophosphate + PE(20:2(11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)) details
CDP-Ethanolamine + DG(20:2(11Z,14Z)/24:0/0:0) → Cytidine monophosphate + PE(20:2(11Z,14Z)/24:0) details
CDP-Ethanolamine + DG(20:2(11Z,14Z)/24:1(15Z)/0:0) → Cytidine monophosphate + PE(20:2(11Z,14Z)/24:1(15Z)) details
CDP-Ethanolamine + DG(20:3(5Z,8Z,11Z)/20:3(5Z,8Z,11Z)/0:0) → Cytidine monophosphate + PE(20:3(5Z,8Z,11Z)/20:3(5Z,8Z,11Z)) details
CDP-Ethanolamine + DG(20:3(5Z,8Z,11Z)/20:3(8Z,11Z,14Z)/0:0) → Cytidine monophosphate + PE(20:3(5Z,8Z,11Z)/20:3(8Z,11Z,14Z)) details
CDP-Ethanolamine + DG(20:3(5Z,8Z,11Z)/20:4(5Z,8Z,11Z,14Z)/0:0) → Cytidine monophosphate + PE(20:3(5Z,8Z,11Z)/20:4(5Z,8Z,11Z,14Z)) details
CDP-Ethanolamine + DG(20:3(5Z,8Z,11Z)/20:4(8Z,11Z,14Z,17Z)/0:0) → Cytidine monophosphate + PE(20:3(5Z,8Z,11Z)/20:4(8Z,11Z,14Z,17Z)) details
CDP-Ethanolamine + DG(20:3(5Z,8Z,11Z)/20:5(5Z,8Z,11Z,14Z,17Z)/0:0) → Cytidine monophosphate + PE(20:3(5Z,8Z,11Z)/20:5(5Z,8Z,11Z,14Z,17Z)) details
CDP-Ethanolamine + DG(20:3(5Z,8Z,11Z)/22:0/0:0) → Cytidine monophosphate + PE(20:3(5Z,8Z,11Z)/22:0) details
CDP-Ethanolamine + DG(20:3(5Z,8Z,11Z)/22:1(13Z)/0:0) → Cytidine monophosphate + PE(20:3(5Z,8Z,11Z)/22:1(13Z)) details
CDP-Ethanolamine + DG(20:3(5Z,8Z,11Z)/22:2(13Z,16Z)/0:0) → Cytidine monophosphate + PE(20:3(5Z,8Z,11Z)/22:2(13Z,16Z)) details
CDP-Ethanolamine + DG(20:3(5Z,8Z,11Z)/22:4(7Z,10Z,13Z,16Z)/0:0) → Cytidine monophosphate + PE(20:3(5Z,8Z,11Z)/22:4(7Z,10Z,13Z,16Z)) details
CDP-Ethanolamine + DG(20:3(5Z,8Z,11Z)/22:5(4Z,7Z,10Z,13Z,16Z)/0:0) → Cytidine monophosphate + PE(20:3(5Z,8Z,11Z)/22:5(4Z,7Z,10Z,13Z,16Z)) details
CDP-Ethanolamine + DG(20:3(5Z,8Z,11Z)/22:5(7Z,10Z,13Z,16Z,19Z)/0:0) → Cytidine monophosphate + PE(20:3(5Z,8Z,11Z)/22:5(7Z,10Z,13Z,16Z,19Z)) details
CDP-Ethanolamine + DG(20:3(5Z,8Z,11Z)/24:0/0:0) → Cytidine monophosphate + PE(20:3(5Z,8Z,11Z)/24:0) details
CDP-Ethanolamine + DG(20:3(5Z,8Z,11Z)/24:1(15Z)/0:0) → Cytidine monophosphate + PE(20:3(5Z,8Z,11Z)/24:1(15Z)) details
CDP-Ethanolamine + DG(20:3(8Z,11Z,14Z)/20:3(8Z,11Z,14Z)/0:0) → Cytidine monophosphate + PE(20:3(8Z,11Z,14Z)/20:3(8Z,11Z,14Z)) details
CDP-Ethanolamine + DG(20:3(8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/0:0) → Cytidine monophosphate + PE(20:3(8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)) details
CDP-Ethanolamine + DG(20:3(8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z)/0:0) → Cytidine monophosphate + PE(20:3(8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z)) details
CDP-Ethanolamine + DG(20:3(8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z)/0:0) → Cytidine monophosphate + PE(20:3(8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z)) details
CDP-Ethanolamine + DG(20:3(8Z,11Z,14Z)/22:0/0:0) → Cytidine monophosphate + PE(20:3(8Z,11Z,14Z)/22:0) details
CDP-Ethanolamine + DG(20:3(8Z,11Z,14Z)/22:1(13Z)/0:0) → Cytidine monophosphate + PE(20:3(8Z,11Z,14Z)/22:1(13Z)) details
CDP-Ethanolamine + DG(20:3(8Z,11Z,14Z)/22:2(13Z,16Z)/0:0) → Cytidine monophosphate + PE(20:3(8Z,11Z,14Z)/22:2(13Z,16Z)) details
CDP-Ethanolamine + DG(20:3(8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z)/0:0) → Cytidine monophosphate + PE(20:3(8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z)) details
CDP-Ethanolamine + DG(20:3(8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/0:0) → Cytidine monophosphate + PE(20:3(8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)) details
CDP-Ethanolamine + DG(20:3(8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/0:0) → Cytidine monophosphate + PE(20:3(8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)) details
CDP-Ethanolamine + DG(20:3(8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/0:0) → Cytidine monophosphate + PE(20:3(8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)) details
CDP-Ethanolamine + DG(20:3(8Z,11Z,14Z)/24:0/0:0) → Cytidine monophosphate + PE(20:3(8Z,11Z,14Z)/24:0) details
CDP-Ethanolamine + DG(20:3(8Z,11Z,14Z)/24:1(15Z)/0:0) → Cytidine monophosphate + PE(20:3(8Z,11Z,14Z)/24:1(15Z)) details
CDP-Ethanolamine + DG(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/0:0) → Cytidine monophosphate + PE(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)) details
CDP-Ethanolamine + DG(20:4(5Z,8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z)/0:0) → Cytidine monophosphate + PE(20:4(5Z,8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z)) details
CDP-Ethanolamine + DG(20:4(5Z,8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z)/0:0) → Cytidine monophosphate + PE(20:4(5Z,8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z)) details
CDP-Ethanolamine + DG(20:4(5Z,8Z,11Z,14Z)/22:0/0:0) → Cytidine monophosphate + PE(20:4(5Z,8Z,11Z,14Z)/22:0) details
CDP-Ethanolamine + DG(20:4(5Z,8Z,11Z,14Z)/22:1(13Z)/0:0) → Cytidine monophosphate + PE(20:4(5Z,8Z,11Z,14Z)/22:1(13Z)) details
CDP-Ethanolamine + DG(20:4(5Z,8Z,11Z,14Z)/22:2(13Z,16Z)/0:0) → Cytidine monophosphate + PE(20:4(5Z,8Z,11Z,14Z)/22:2(13Z,16Z)) details
CDP-Ethanolamine + DG(20:4(5Z,8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z)/0:0) → Cytidine monophosphate + PE(20:4(5Z,8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z)) details
CDP-Ethanolamine + DG(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)/0:0) → Cytidine monophosphate + PE(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z)) details
CDP-Ethanolamine + DG(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)/0:0) → Cytidine monophosphate + PE(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z)) details
CDP-Ethanolamine + DG(20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/0:0) → Cytidine monophosphate + PE(20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)) details
CDP-Ethanolamine + DG(20:4(5Z,8Z,11Z,14Z)/24:0/0:0) → Cytidine monophosphate + PE(20:4(5Z,8Z,11Z,14Z)/24:0) details
CDP-Ethanolamine + DG(20:4(5Z,8Z,11Z,14Z)/24:1(15Z)/0:0) → Cytidine monophosphate + PE(20:4(5Z,8Z,11Z,14Z)/24:1(15Z)) details
CDP-Ethanolamine + DG(20:4(8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z)/0:0) → Cytidine monophosphate + PE(20:4(8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z)) details
CDP-Ethanolamine + DG(20:4(8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z)/0:0) → Cytidine monophosphate + PE(20:4(8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z)) details
CDP-Ethanolamine + DG(20:4(8Z,11Z,14Z,17Z)/22:0/0:0) → Cytidine monophosphate + PE(20:4(8Z,11Z,14Z,17Z)/22:0) details
CDP-Ethanolamine + DG(20:4(8Z,11Z,14Z,17Z)/22:1(13Z)/0:0) → Cytidine monophosphate + PE(20:4(8Z,11Z,14Z,17Z)/22:1(13Z)) details
CDP-Ethanolamine + DG(20:4(8Z,11Z,14Z,17Z)/22:2(13Z,16Z)/0:0) → Cytidine monophosphate + PE(20:4(8Z,11Z,14Z,17Z)/22:2(13Z,16Z)) details
CDP-Ethanolamine + DG(20:4(8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z)/0:0) → Cytidine monophosphate + PE(20:4(8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z)) details
CDP-Ethanolamine + DG(20:4(8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z)/0:0) → Cytidine monophosphate + PE(20:4(8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z)) details
CDP-Ethanolamine + DG(20:4(8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z)/0:0) → Cytidine monophosphate + PE(20:4(8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z)) details
CDP-Ethanolamine + DG(20:4(8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/0:0) → Cytidine monophosphate + PE(20:4(8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)) details
CDP-Ethanolamine + DG(20:4(8Z,11Z,14Z,17Z)/24:0/0:0) → Cytidine monophosphate + PE(20:4(8Z,11Z,14Z,17Z)/24:0) details
CDP-Ethanolamine + DG(20:4(8Z,11Z,14Z,17Z)/24:1(15Z)/0:0) → Cytidine monophosphate + PE(20:4(8Z,11Z,14Z,17Z)/24:1(15Z)) details
CDP-Ethanolamine + DG(20:5(5Z,8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z)/0:0) → Cytidine monophosphate + PE(20:5(5Z,8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z)) details
CDP-Ethanolamine + DG(20:5(5Z,8Z,11Z,14Z,17Z)/22:0/0:0) → Cytidine monophosphate + PE(20:5(5Z,8Z,11Z,14Z,17Z)/22:0) details
CDP-Ethanolamine + DG(20:5(5Z,8Z,11Z,14Z,17Z)/22:1(13Z)/0:0) → Cytidine monophosphate + PE(20:5(5Z,8Z,11Z,14Z,17Z)/22:1(13Z)) details
CDP-Ethanolamine + DG(20:5(5Z,8Z,11Z,14Z,17Z)/22:2(13Z,16Z)/0:0) → Cytidine monophosphate + PE(20:5(5Z,8Z,11Z,14Z,17Z)/22:2(13Z,16Z)) details
CDP-Ethanolamine + DG(20:5(5Z,8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z)/0:0) → Cytidine monophosphate + PE(20:5(5Z,8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z)) details
CDP-Ethanolamine + DG(20:5(5Z,8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z)/0:0) → Cytidine monophosphate + PE(20:5(5Z,8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z)) details
CDP-Ethanolamine + DG(20:5(5Z,8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z)/0:0) → Cytidine monophosphate + PE(20:5(5Z,8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z)) details
CDP-Ethanolamine + DG(20:5(5Z,8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/0:0) → Cytidine monophosphate + PE(20:5(5Z,8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)) details
CDP-Ethanolamine + DG(20:5(5Z,8Z,11Z,14Z,17Z)/24:0/0:0) → Cytidine monophosphate + PE(20:5(5Z,8Z,11Z,14Z,17Z)/24:0) details
CDP-Ethanolamine + DG(20:5(5Z,8Z,11Z,14Z,17Z)/24:1(15Z)/0:0) → Cytidine monophosphate + PE(20:5(5Z,8Z,11Z,14Z,17Z)/24:1(15Z)) details
CDP-Ethanolamine + DG(22:0/22:0/0:0) → Cytidine monophosphate + PE(22:0/22:0) details
CDP-Ethanolamine + DG(22:0/22:1(13Z)/0:0) → Cytidine monophosphate + PE(22:0/22:1(13Z)) details
CDP-Ethanolamine + DG(22:0/22:2(13Z,16Z)/0:0) → Cytidine monophosphate + PE(22:0/22:2(13Z,16Z)) details
CDP-Ethanolamine + DG(22:0/22:4(7Z,10Z,13Z,16Z)/0:0) → Cytidine monophosphate + PE(22:0/22:4(7Z,10Z,13Z,16Z)) details
CDP-Ethanolamine + DG(22:0/22:5(4Z,7Z,10Z,13Z,16Z)/0:0) → Cytidine monophosphate + PE(22:0/22:5(4Z,7Z,10Z,13Z,16Z)) details
CDP-Ethanolamine + DG(22:0/22:5(7Z,10Z,13Z,16Z,19Z)/0:0) → Cytidine monophosphate + PE(22:0/22:5(7Z,10Z,13Z,16Z,19Z)) details
CDP-Ethanolamine + DG(22:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/0:0) → Cytidine monophosphate + PE(22:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z)) details
CDP-Ethanolamine + DG(22:0/24:0/0:0) → Cytidine monophosphate + PE(22:0/24:0) details
CDP-Ethanolamine + DG(22:0/24:1(15Z)/0:0) → Cytidine monophosphate + PE(22:0/24:1(15Z)) details
CDP-Ethanolamine + DG(22:1(13Z)/22:1(13Z)/0:0) → Cytidine monophosphate + PE(22:1(13Z)/22:1(13Z)) details
CDP-Ethanolamine + DG(22:1(13Z)/22:2(13Z,16Z)/0:0) → Cytidine monophosphate + PE(22:1(13Z)/22:2(13Z,16Z)) details
CDP-Ethanolamine + DG(22:1(13Z)/22:4(7Z,10Z,13Z,16Z)/0:0) → Cytidine monophosphate + PE(22:1(13Z)/22:4(7Z,10Z,13Z,16Z)) details
CDP-Ethanolamine + DG(22:1(13Z)/22:5(4Z,7Z,10Z,13Z,16Z)/0:0) → Cytidine monophosphate + PE(22:1(13Z)/22:5(4Z,7Z,10Z,13Z,16Z)) details
CDP-Ethanolamine + DG(22:1(13Z)/22:5(7Z,10Z,13Z,16Z,19Z)/0:0) → Cytidine monophosphate + PE(22:1(13Z)/22:5(7Z,10Z,13Z,16Z,19Z)) details
CDP-Ethanolamine + DG(22:1(13Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/0:0) → Cytidine monophosphate + PE(22:1(13Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)) details
CDP-Ethanolamine + DG(22:1(13Z)/24:0/0:0) → Cytidine monophosphate + PE(22:1(13Z)/24:0) details
CDP-Ethanolamine + DG(22:1(13Z)/24:1(15Z)/0:0) → Cytidine monophosphate + PE(22:1(13Z)/24:1(15Z)) details
CDP-Ethanolamine + DG(22:2(13Z,16Z)/22:2(13Z,16Z)/0:0) → Cytidine monophosphate + PE(22:2(13Z,16Z)/22:2(13Z,16Z)) details
CDP-Ethanolamine + DG(22:2(13Z,16Z)/22:4(7Z,10Z,13Z,16Z)/0:0) → Cytidine monophosphate + PE(22:2(13Z,16Z)/22:4(7Z,10Z,13Z,16Z)) details
CDP-Ethanolamine + DG(22:2(13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/0:0) → Cytidine monophosphate + PE(22:2(13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)) details
CDP-Ethanolamine + DG(22:2(13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/0:0) → Cytidine monophosphate + PE(22:2(13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)) details
CDP-Ethanolamine + DG(22:2(13Z,16Z)/24:0/0:0) → Cytidine monophosphate + PE(22:2(13Z,16Z)/24:0) details
CDP-Ethanolamine + DG(22:2(13Z,16Z)/24:1(15Z)/0:0) → Cytidine monophosphate + PE(22:2(13Z,16Z)/24:1(15Z)) details
CDP-Ethanolamine + DG(22:4(7Z,10Z,13Z,16Z)/22:4(7Z,10Z,13Z,16Z)/0:0) → Cytidine monophosphate + PE(22:4(7Z,10Z,13Z,16Z)/22:4(7Z,10Z,13Z,16Z)) details
CDP-Ethanolamine + DG(22:4(7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/0:0) → Cytidine monophosphate + PE(22:4(7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)) details
CDP-Ethanolamine + DG(22:4(7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/0:0) → Cytidine monophosphate + PE(22:4(7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)) details
CDP-Ethanolamine + DG(22:4(7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/0:0) → Cytidine monophosphate + PE(22:4(7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)) details
CDP-Ethanolamine + DG(22:4(7Z,10Z,13Z,16Z)/24:0/0:0) → Cytidine monophosphate + PE(22:4(7Z,10Z,13Z,16Z)/24:0) details
CDP-Ethanolamine + DG(22:4(7Z,10Z,13Z,16Z)/24:1(15Z)/0:0) → Cytidine monophosphate + PE(22:4(7Z,10Z,13Z,16Z)/24:1(15Z)) details
CDP-Ethanolamine + DG(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)/0:0) → Cytidine monophosphate + PE(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z)) details
CDP-Ethanolamine + DG(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)/0:0) → Cytidine monophosphate + PE(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z)) details
CDP-Ethanolamine + DG(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/0:0) → Cytidine monophosphate + PE(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)) details
CDP-Ethanolamine + DG(22:5(4Z,7Z,10Z,13Z,16Z)/24:0/0:0) → Cytidine monophosphate + PE(22:5(4Z,7Z,10Z,13Z,16Z)/24:0) details
CDP-Ethanolamine + DG(22:5(4Z,7Z,10Z,13Z,16Z)/24:1(15Z)/0:0) → Cytidine monophosphate + PE(22:5(4Z,7Z,10Z,13Z,16Z)/24:1(15Z)) details
CDP-Ethanolamine + DG(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)/0:0) → Cytidine monophosphate + PE(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z)) details
CDP-Ethanolamine + DG(22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/0:0) → Cytidine monophosphate + PE(22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)) details
CDP-Ethanolamine + DG(22:5(7Z,10Z,13Z,16Z,19Z)/24:0/0:0) → Cytidine monophosphate + PE(22:5(7Z,10Z,13Z,16Z,19Z)/24:0) details
CDP-Ethanolamine + DG(22:5(7Z,10Z,13Z,16Z,19Z)/24:1(15Z)/0:0) → Cytidine monophosphate + PE(22:5(7Z,10Z,13Z,16Z,19Z)/24:1(15Z)) details
CDP-Ethanolamine + DG(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)/0:0) → Cytidine monophosphate + PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z)) details
CDP-Ethanolamine + DG(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:0/0:0) → Cytidine monophosphate + PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:0) details
CDP-Ethanolamine + DG(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:1(15Z)/0:0) → Cytidine monophosphate + PE(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:1(15Z)) details
CDP-Ethanolamine + DG(24:0/24:0/0:0) → Cytidine monophosphate + PE(24:0/24:0) details
CDP-Ethanolamine + DG(24:0/24:1(15Z)/0:0) → Cytidine monophosphate + PE(24:0/24:1(15Z)) details
CDP-Ethanolamine + DG(24:1(15Z)/24:1(15Z)/0:0) → Cytidine monophosphate + PE(24:1(15Z)/24:1(15Z)) details
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 11
Locus Not Available
SNPs SELENOI
Gene Sequence
>1161 bp
ATGGCAAGTTACGAATACGTGAGCCCGGAGCAGCTGGCTGGCTTTGATAAGTACAAGTAC
AGTGCTGTGGATACCAATCCACTCTCTCTGTATGTCATGCACCCATTTTGGAACACTGTA
GTAAAGGTATTTCCTACTTGGCTGGCTCCAAATCTGATAACCTTCTCTGGCTTTCTGCTG
GTTGTGTTCAATTTTCTACTTTTGGCATACTTTGATCCTGACTTTTATGCTTCAGCACCA
GGTCACAAGCATGTACCCGACTGGGTCTGGATTGTAGTGGGCATCCTCAACTTCATGGCC
TACACTCTAGATGGTGTGGACGGAAAGCAAGCCCGCAGAACCAATTCCAGCACCCCGCTG
GGGGAGCTTTTTGACCACGGCCTGGATAGTTGGTCGTGTGTTTACTTTGTTGTCACCGTG
TATTCCATTTTTGGACGAGGATCATCTGGTGTCAGTGTTTTCGTTCTTTATCTCCTGCTA
TGGGTAGTTTTGTTTTCTTTCATCCTGTCTCACTGGGAAAAGTATAACACAGGGATTCTT
TTCCTGCCATGGGGATATGACATTAGCCAGGTGACTATTTCTTTTGTCTACATAGTGACT
GCGGTTGTGGGAGTTGAGGCCTGGTATGAACCTTTCCTGTTTAATTTCTTATATAGAGAC
CTATTCACTGCAATGATCTTTGGTTGTGCACTGTGCGTGACTCTTCCAATGAGTTTGTTA
AATTTTTTCAGAAGCTATAAAAATAACACGTTGAAACACAATTCAGTCTATGAAGCTGTG
GTTCCCTTCTTTTCTCCATGTTTGCTATTCATTTTGTCTACAGCGTGGATCCTCCTGTCA
CCTTCAGATATTTTAGAGTTACACCCTAGAGTGTTCTACTTAATGGTTGGAACAGCCTTT
GCCAACAGCACATGTCAGCTGATTGTTTGTCAAATGAGCAGTACCCGGTGCCCGACTTTG
AACTGGTTGCTGCTTCCTCTTTTTGTGATTGTCATGGTGGTGAATGTAGGAGTAACCCCT
TACGTTGAGAGCATTCTCCTGTTTACGCTAACGGCTGCTTTCACTTTGGCCCACATCCAC
TATGGAGTACGAGTGGTAAAGCAGCTGAGCAACCATTTTCACATTTACCCCTTCTCCTTG
AGAAAACCAAACTCGGATTGA
Protein Properties
Number of Residues 397
Molecular Weight 45214.0
Theoretical pI 6.73
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • 47-69
  • 84-103
  • 123-145
  • 150-172
  • 179-201
  • 221-243
  • 256-278
  • 291-310
  • 317-339
  • 344-366
Protein Sequence
>Ethanolaminephosphotransferase 1
MASYEYVSPEQLAGFDKYKYSAVDTNPLSLYVMHPFWNTVVKVFPTWLAPNLITFSGFLL
VVFNFLLLAYFDPDFYASAPGHKHVPDWVWIVVGILNFMAYTLDGVDGKQARRTNSSTPL
GELFDHGLDSWSCVYFVVTVYSIFGRGSSGVSVFVLYLLLWVVLFSFILSHWEKYNTGIL
FLPWGYDISQVTISFVYIVTAVVGVEAWYEPFLFNFLYRDLFTAMIFGCALCVTLPMSLL
NFFRSYKNNTLKHNSVYEAVVPFFSPCLLFILSTAWILLSPSDILELHPRVFYLMVGTAF
ANSTCQLIVCQMSSTRCPTLNWLLLPLFVIVMVVNVGVTPYVESILLFTLTAAFTLAHIH
YGVRVVKQLSNHFHIYPFSLRKPNSDULGVEEKNIGL
GenBank ID Protein AAI18274.1
UniProtKB/Swiss-Prot ID Q17QM4
UniProtKB/Swiss-Prot Entry Name EPT1_BOVIN
PDB IDs Not Available
GenBank Gene ID BC118273
GeneCard ID SELENOI
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available