Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00420
Secondary Accession Numbers None
Name Phosphatidylethanolamine N-methyltransferase
Synonyms Not Available
Gene Name PEMT
Protein Type Enzyme
Biological Properties
General Function Involved in phosphatidylethanolamine N-methyltransferas
Specific Function Catalyzes the three sequential steps of the methylation pathway of phosphatidylcholine biosynthesis, the SAM-dependent methylation of phosphatidylethanolamine (PE) to phosphatidylmonomethylethanolamine (PMME), PMME to phosphatidyldimethylethanolamine (PDME), and PDME to phosphatidylcholine (PC).
Pathways
  • Betaine Metabolism
  • Phosphatidylcholine Biosynthesis
  • Phosphatidylcholine Biosynthesis PC(14:0/14:0)
  • Phosphatidylcholine Biosynthesis PC(14:0/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/15:0)
  • Phosphatidylcholine Biosynthesis PC(14:0/16:0)
  • Phosphatidylcholine Biosynthesis PC(14:0/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/18:0)
  • Phosphatidylcholine Biosynthesis PC(14:0/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/20:0)
  • Phosphatidylcholine Biosynthesis PC(14:0/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/22:0)
  • Phosphatidylcholine Biosynthesis PC(14:0/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/24:0)
  • Phosphatidylcholine Biosynthesis PC(14:0/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/15:0)
  • Phosphatidylcholine Biosynthesis PC(15:0/16:0)
  • Phosphatidylcholine Biosynthesis PC(15:0/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/18:0)
  • Phosphatidylcholine Biosynthesis PC(15:0/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/20:0)
  • Phosphatidylcholine Biosynthesis PC(15:0/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/22:0)
  • Phosphatidylcholine Biosynthesis PC(15:0/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/24:0)
  • Phosphatidylcholine Biosynthesis PC(15:0/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/16:0)
  • Phosphatidylcholine Biosynthesis PC(16:0/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/18:0)
  • Phosphatidylcholine Biosynthesis PC(16:0/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/20:0)
  • Phosphatidylcholine Biosynthesis PC(16:0/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/22:0)
  • Phosphatidylcholine Biosynthesis PC(16:0/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/24:0)
  • Phosphatidylcholine Biosynthesis PC(16:0/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/18:0)
  • Phosphatidylcholine Biosynthesis PC(18:0/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/20:0)
  • Phosphatidylcholine Biosynthesis PC(18:0/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/22:0)
  • Phosphatidylcholine Biosynthesis PC(18:0/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/24:0)
  • Phosphatidylcholine Biosynthesis PC(18:0/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/20:0)
  • Phosphatidylcholine Biosynthesis PC(20:0/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:0/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:0/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/22:0)
  • Phosphatidylcholine Biosynthesis PC(22:0/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/24:0)
  • Phosphatidylcholine Biosynthesis PC(22:0/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/24:0)
  • Phosphatidylcholine Biosynthesis PC(24:0/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/24:1(15Z))
  • Phospholipid Biosynthesis
  • Phospholipid metabolism
Reactions
S-Adenosylmethionine + Phosphatidyl-N-dimethylethanolamine → S-Adenosylhomocysteine + Phosphatidylcholine details
S-Adenosylmethionine + an L-1-Phosphatidylethanolamine → S-Adenosylhomocysteine + Phosphatidyl-N-methylethanolamine details
S-Adenosylmethionine + Phosphatidyl-N-methylethanolamine → S-Adenosylhomocysteine + Phosphatidyl-N-dimethylethanolamine details
S-Adenosylmethionine + PE(16:0/16:0) → S-Adenosylhomocysteine + PE-NMe(16:0/16:0) details
PE-NMe(16:0/16:0) + S-Adenosylmethionine → PE-NMe2(16:0/16:0) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(16:0/16:0) → S-Adenosylhomocysteine + PC(16:0/16:0) details
S-Adenosylmethionine + PE(16:0/18:0) → S-Adenosylhomocysteine + PE-NMe(16:0/18:0) details
PE-NMe(16:0/18:0) + S-Adenosylmethionine → PE-NMe2(16:0/18:0) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(16:0/18:0) → S-Adenosylhomocysteine + PC(16:0/18:0) details
S-Adenosylmethionine + PE(16:0/18:1(11Z)) → S-Adenosylhomocysteine + PE-NMe(16:0/18:1(11Z)) details
PE-NMe(16:0/18:1(11Z)) + S-Adenosylmethionine → PE-NMe2(16:0/18:1(11Z)) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(16:0/18:1(11Z)) → S-Adenosylhomocysteine + PC(16:0/18:1(11Z)) details
S-Adenosylmethionine + PE(16:0/18:1(9Z)) → S-Adenosylhomocysteine + PE-NMe(16:0/18:1(9Z)) details
PE-NMe(16:0/18:1(9Z)) + S-Adenosylmethionine → PE-NMe2(16:0/18:1(9Z)) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(16:0/18:1(9Z)) → S-Adenosylhomocysteine + PC(16:0/18:1(9Z)) details
S-Adenosylmethionine + PE(16:0/18:2(9Z,12Z)) → S-Adenosylhomocysteine + PE-NMe(16:0/18:2(9Z,12Z)) details
PE-NMe(16:0/18:2(9Z,12Z)) + S-Adenosylmethionine → PE-NMe2(16:0/18:2(9Z,12Z)) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(16:0/18:2(9Z,12Z)) → S-Adenosylhomocysteine + PC(16:0/18:2(9Z,12Z)) details
S-Adenosylmethionine + PE(16:0/18:3(6Z,9Z,12Z)) → S-Adenosylhomocysteine + PE-NMe(16:0/18:3(6Z,9Z,12Z)) details
PE-NMe(16:0/18:3(6Z,9Z,12Z)) + S-Adenosylmethionine → PE-NMe2(16:0/18:3(6Z,9Z,12Z)) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(16:0/18:3(6Z,9Z,12Z)) → S-Adenosylhomocysteine + PC(16:0/18:3(6Z,9Z,12Z)) details
S-Adenosylmethionine + PE(16:0/18:3(9Z,12Z,15Z)) → S-Adenosylhomocysteine + PE-NMe(16:0/18:3(9Z,12Z,15Z)) details
PE-NMe(16:0/18:3(9Z,12Z,15Z)) + S-Adenosylmethionine → PE-NMe2(16:0/18:3(9Z,12Z,15Z)) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(16:0/18:3(9Z,12Z,15Z)) → S-Adenosylhomocysteine + PC(16:0/18:3(9Z,12Z,15Z)) details
S-Adenosylmethionine + PE(16:0/20:0) → S-Adenosylhomocysteine + PE-NMe(16:0/20:0) details
PE-NMe(16:0/20:0) + S-Adenosylmethionine → PE-NMe2(16:0/20:0) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(16:0/20:0) → S-Adenosylhomocysteine + PC(16:0/20:0) details
S-Adenosylmethionine + PE(16:0/20:1(11Z)) → S-Adenosylhomocysteine + PE-NMe(16:0/20:1(11Z)) details
PE-NMe(16:0/20:1(11Z)) + S-Adenosylmethionine → PE-NMe2(16:0/20:1(11Z)) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(16:0/20:1(11Z)) → S-Adenosylhomocysteine + PC(16:0/20:1(11Z)) details
S-Adenosylmethionine + PE(16:0/22:0) → S-Adenosylhomocysteine + PE-NMe(16:0/22:0) details
PE-NMe(16:0/22:0) + S-Adenosylmethionine → PE-NMe2(16:0/22:0) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(16:0/22:0) → S-Adenosylhomocysteine + PC(16:0/22:0) details
S-Adenosylmethionine + PE(16:0/22:1(13Z)) → S-Adenosylhomocysteine + PE-NMe(16:0/22:1(13Z)) details
PE-NMe(16:0/22:1(13Z)) + S-Adenosylmethionine → PE-NMe2(16:0/22:1(13Z)) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(16:0/22:1(13Z)) → S-Adenosylhomocysteine + PC(16:0/22:1(13Z)) details
S-Adenosylmethionine + PE(18:0/18:0) → S-Adenosylhomocysteine + PE-NMe(18:0/18:0) details
PE-NMe(18:0/18:0) + S-Adenosylmethionine → PE-NMe2(18:0/18:0) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(18:0/18:0) → S-Adenosylhomocysteine + PC(18:0/18:0) details
S-Adenosylmethionine + PE(18:0/18:1(11Z)) → S-Adenosylhomocysteine + PE-NMe(18:0/18:1(11Z)) details
PE-NMe(18:0/18:1(11Z)) + S-Adenosylmethionine → PE-NMe2(18:0/18:1(11Z)) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(18:0/18:1(11Z)) → S-Adenosylhomocysteine + PC(18:0/18:1(11Z)) details
S-Adenosylmethionine + PE(18:0/18:1(9Z)) → S-Adenosylhomocysteine + PE-NMe(18:0/18:1(9Z)) details
PE-NMe(18:0/18:1(9Z)) + S-Adenosylmethionine → PE-NMe2(18:0/18:1(9Z)) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(18:0/18:1(9Z)) → S-Adenosylhomocysteine + PC(18:0/18:1(9Z)) details
S-Adenosylmethionine + PE(18:0/18:2(9Z,12Z)) → S-Adenosylhomocysteine + PE-NMe(18:0/18:2(9Z,12Z)) details
PE-NMe(18:0/18:2(9Z,12Z)) + S-Adenosylmethionine → PE-NMe2(18:0/18:2(9Z,12Z)) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(18:0/18:2(9Z,12Z)) → S-Adenosylhomocysteine + PC(18:0/18:2(9Z,12Z)) details
S-Adenosylmethionine + PE(18:0/18:3(6Z,9Z,12Z)) → S-Adenosylhomocysteine + PE-NMe(18:0/18:3(6Z,9Z,12Z)) details
PE-NMe(18:0/18:3(6Z,9Z,12Z)) + S-Adenosylmethionine → PE-NMe2(18:0/18:3(6Z,9Z,12Z)) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(18:0/18:3(6Z,9Z,12Z)) → S-Adenosylhomocysteine + PC(18:0/18:3(6Z,9Z,12Z)) details
S-Adenosylmethionine + PE(18:0/18:3(9Z,12Z,15Z)) → S-Adenosylhomocysteine + PE-NMe(18:0/18:3(9Z,12Z,15Z)) details
PE-NMe(18:0/18:3(9Z,12Z,15Z)) + S-Adenosylmethionine → PE-NMe2(18:0/18:3(9Z,12Z,15Z)) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(18:0/18:3(9Z,12Z,15Z)) → S-Adenosylhomocysteine + PC(18:0/18:3(9Z,12Z,15Z)) details
S-Adenosylmethionine + PE(18:0/20:0) → S-Adenosylhomocysteine + PE-NMe(18:0/20:0) details
PE-NMe(18:0/20:0) + S-Adenosylmethionine → PE-NMe2(18:0/20:0) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(18:0/20:0) → S-Adenosylhomocysteine + PC(18:0/20:0) details
S-Adenosylmethionine + PE(18:0/20:1(11Z)) → S-Adenosylhomocysteine + PE-NMe(18:0/20:1(11Z)) details
PE-NMe(18:0/20:1(11Z)) + S-Adenosylmethionine → PE-NMe2(18:0/20:1(11Z)) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(18:0/20:1(11Z)) → S-Adenosylhomocysteine + PC(18:0/20:1(11Z)) details
S-Adenosylmethionine + PE(18:0/22:0) → S-Adenosylhomocysteine + PE-NMe(18:0/22:0) details
PE-NMe(18:0/22:0) + S-Adenosylmethionine → PE-NMe2(18:0/22:0) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(18:0/22:0) → S-Adenosylhomocysteine + PC(18:0/22:0) details
S-Adenosylmethionine + PE(18:0/22:1(13Z)) → S-Adenosylhomocysteine + PE-NMe(18:0/22:1(13Z)) details
PE-NMe(18:0/22:1(13Z)) + S-Adenosylmethionine → PE-NMe2(18:0/22:1(13Z)) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(18:0/22:1(13Z)) → S-Adenosylhomocysteine + PC(18:0/22:1(13Z)) details
S-Adenosylmethionine + PE(18:1(11Z)/18:1(11Z)) → S-Adenosylhomocysteine + PE-NMe(18:1(11Z)/18:1(11Z)) details
PE-NMe(18:1(11Z)/18:1(11Z)) + S-Adenosylmethionine → PE-NMe2(18:1(11Z)/18:1(11Z)) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(18:1(11Z)/18:1(11Z)) → S-Adenosylhomocysteine + PC(18:1(11Z)/18:1(11Z)) details
S-Adenosylmethionine + PE(18:1(11Z)/18:2(9Z,12Z)) → S-Adenosylhomocysteine + PE-NMe(18:1(11Z)/18:2(9Z,12Z)) details
PE-NMe(18:1(11Z)/18:2(9Z,12Z)) + S-Adenosylmethionine → PE-NMe2(18:1(11Z)/18:2(9Z,12Z)) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(18:1(11Z)/18:2(9Z,12Z)) → S-Adenosylhomocysteine + PC(18:1(11Z)/18:2(9Z,12Z)) details
S-Adenosylmethionine + PE(18:1(11Z)/18:3(6Z,9Z,12Z)) → S-Adenosylhomocysteine + PE-NMe(18:1(11Z)/18:3(6Z,9Z,12Z)) details
PE-NMe(18:1(11Z)/18:3(6Z,9Z,12Z)) + S-Adenosylmethionine → PE-NMe2(18:1(11Z)/18:3(6Z,9Z,12Z)) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(18:1(11Z)/18:3(6Z,9Z,12Z)) → S-Adenosylhomocysteine + PC(18:1(11Z)/18:3(6Z,9Z,12Z)) details
S-Adenosylmethionine + PE(18:1(11Z)/18:3(9Z,12Z,15Z)) → S-Adenosylhomocysteine + PE-NMe(18:1(11Z)/18:3(9Z,12Z,15Z)) details
PE-NMe(18:1(11Z)/18:3(9Z,12Z,15Z)) + S-Adenosylmethionine → PE-NMe2(18:1(11Z)/18:3(9Z,12Z,15Z)) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(18:1(11Z)/18:3(9Z,12Z,15Z)) → S-Adenosylhomocysteine + PC(18:1(11Z)/18:3(9Z,12Z,15Z)) details
S-Adenosylmethionine + PE(18:1(11Z)/20:0) → S-Adenosylhomocysteine + PE-NMe(18:1(11Z)/20:0) details
PE-NMe(18:1(11Z)/20:0) + S-Adenosylmethionine → PE-NMe2(18:1(11Z)/20:0) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(18:1(11Z)/20:0) → S-Adenosylhomocysteine + PC(18:1(11Z)/20:0) details
S-Adenosylmethionine + PE(18:1(11Z)/20:1(11Z)) → S-Adenosylhomocysteine + PE-NMe(18:1(11Z)/20:1(11Z)) details
PE-NMe(18:1(11Z)/20:1(11Z)) + S-Adenosylmethionine → PE-NMe2(18:1(11Z)/20:1(11Z)) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(18:1(11Z)/20:1(11Z)) → S-Adenosylhomocysteine + PC(18:1(11Z)/20:1(11Z)) details
S-Adenosylmethionine + PE(18:1(11Z)/22:0) → S-Adenosylhomocysteine + PE-NMe(18:1(11Z)/22:0) details
PE-NMe(18:1(11Z)/22:0) + S-Adenosylmethionine → PE-NMe2(18:1(11Z)/22:0) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(18:1(11Z)/22:0) → S-Adenosylhomocysteine + PC(18:1(11Z)/22:0) details
S-Adenosylmethionine + PE(18:1(11Z)/22:1(13Z)) → S-Adenosylhomocysteine + PE-NMe(18:1(11Z)/22:1(13Z)) details
PE-NMe(18:1(11Z)/22:1(13Z)) + S-Adenosylmethionine → PE-NMe2(18:1(11Z)/22:1(13Z)) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(18:1(11Z)/22:1(13Z)) → S-Adenosylhomocysteine + PC(18:1(11Z)/22:1(13Z)) details
S-Adenosylmethionine + PE(18:1(9Z)/18:1(9Z)) → S-Adenosylhomocysteine + PE-NMe(18:1(9Z)/18:1(9Z)) details
PE-NMe(18:1(9Z)/18:1(9Z)) + S-Adenosylmethionine → PE-NMe2(18:1(9Z)/18:1(9Z)) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(18:1(9Z)/18:1(9Z)) → S-Adenosylhomocysteine + PC(18:1(9Z)/18:1(9Z)) details
S-Adenosylmethionine + PE(18:1(9Z)/18:2(9Z,12Z)) → S-Adenosylhomocysteine + PE-NMe(18:1(9Z)/18:2(9Z,12Z)) details
PE-NMe(18:1(9Z)/18:2(9Z,12Z)) + S-Adenosylmethionine → PE-NMe2(18:1(9Z)/18:2(9Z,12Z)) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(18:1(9Z)/18:2(9Z,12Z)) → S-Adenosylhomocysteine + PC(18:1(9Z)/18:2(9Z,12Z)) details
S-Adenosylmethionine + PE(18:1(9Z)/18:3(6Z,9Z,12Z)) → S-Adenosylhomocysteine + PE-NMe(18:1(9Z)/18:3(6Z,9Z,12Z)) details
PE-NMe(18:1(9Z)/18:3(6Z,9Z,12Z)) + S-Adenosylmethionine → PE-NMe2(18:1(9Z)/18:3(6Z,9Z,12Z)) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(18:1(9Z)/18:3(6Z,9Z,12Z)) → S-Adenosylhomocysteine + PC(18:1(9Z)/18:3(6Z,9Z,12Z)) details
S-Adenosylmethionine + PE(18:1(9Z)/18:3(9Z,12Z,15Z)) → S-Adenosylhomocysteine + PE-NMe(18:1(9Z)/18:3(9Z,12Z,15Z)) details
PE-NMe(18:1(9Z)/18:3(9Z,12Z,15Z)) + S-Adenosylmethionine → PE-NMe2(18:1(9Z)/18:3(9Z,12Z,15Z)) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(18:1(9Z)/18:3(9Z,12Z,15Z)) → S-Adenosylhomocysteine + PC(18:1(9Z)/18:3(9Z,12Z,15Z)) details
S-Adenosylmethionine + PE(18:1(9Z)/20:0) → S-Adenosylhomocysteine + PE-NMe(18:1(9Z)/20:0) details
PE-NMe(18:1(9Z)/20:0) + S-Adenosylmethionine → PE-NMe2(18:1(9Z)/20:0) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(18:1(9Z)/20:0) → S-Adenosylhomocysteine + PC(18:1(9Z)/20:0) details
S-Adenosylmethionine + PE(18:1(9Z)/20:1(11Z)) → S-Adenosylhomocysteine + PE-NMe(18:1(9Z)/20:1(11Z)) details
PE-NMe(18:1(9Z)/20:1(11Z)) + S-Adenosylmethionine → PE-NMe2(18:1(9Z)/20:1(11Z)) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(18:1(9Z)/20:1(11Z)) → S-Adenosylhomocysteine + PC(18:1(9Z)/20:1(11Z)) details
S-Adenosylmethionine + PE(18:1(9Z)/22:0) → S-Adenosylhomocysteine + PE-NMe(18:1(9Z)/22:0) details
PE-NMe(18:1(9Z)/22:0) + S-Adenosylmethionine → PE-NMe2(18:1(9Z)/22:0) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(18:1(9Z)/22:0) → S-Adenosylhomocysteine + PC(18:1(9Z)/22:0) details
S-Adenosylmethionine + PE(18:1(9Z)/22:1(13Z)) → S-Adenosylhomocysteine + PE-NMe(18:1(9Z)/22:1(13Z)) details
PE-NMe(18:1(9Z)/22:1(13Z)) + S-Adenosylmethionine → PE-NMe2(18:1(9Z)/22:1(13Z)) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(18:1(9Z)/22:1(13Z)) → S-Adenosylhomocysteine + PC(18:1(9Z)/22:1(13Z)) details
S-Adenosylmethionine + PE(18:2(9Z,12Z)/18:2(9Z,12Z)) → S-Adenosylhomocysteine + PE-NMe(18:2(9Z,12Z)/18:2(9Z,12Z)) details
PE-NMe(18:2(9Z,12Z)/18:2(9Z,12Z)) + S-Adenosylmethionine → PE-NMe2(18:2(9Z,12Z)/18:2(9Z,12Z)) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(18:2(9Z,12Z)/18:2(9Z,12Z)) → S-Adenosylhomocysteine + PC(18:2(9Z,12Z)/18:2(9Z,12Z)) details
S-Adenosylmethionine + PE(18:2(9Z,12Z)/18:3(6Z,9Z,12Z)) → S-Adenosylhomocysteine + PE-NMe(18:2(9Z,12Z)/18:3(6Z,9Z,12Z)) details
PE-NMe(18:2(9Z,12Z)/18:3(6Z,9Z,12Z)) + S-Adenosylmethionine → PE-NMe2(18:2(9Z,12Z)/18:3(6Z,9Z,12Z)) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(18:2(9Z,12Z)/18:3(6Z,9Z,12Z)) → S-Adenosylhomocysteine + PC(18:2(9Z,12Z)/18:3(6Z,9Z,12Z)) details
S-Adenosylmethionine + PE(18:2(9Z,12Z)/18:3(9Z,12Z,15Z)) → S-Adenosylhomocysteine + PE-NMe(18:2(9Z,12Z)/18:3(9Z,12Z,15Z)) details
PE-NMe(18:2(9Z,12Z)/18:3(9Z,12Z,15Z)) + S-Adenosylmethionine → PE-NMe2(18:2(9Z,12Z)/18:3(9Z,12Z,15Z)) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(18:2(9Z,12Z)/18:3(9Z,12Z,15Z)) → S-Adenosylhomocysteine + PC(18:2(9Z,12Z)/18:3(9Z,12Z,15Z)) details
S-Adenosylmethionine + PE(18:2(9Z,12Z)/20:0) → S-Adenosylhomocysteine + PE-NMe(18:2(9Z,12Z)/20:0) details
PE-NMe(18:2(9Z,12Z)/20:0) + S-Adenosylmethionine → PE-NMe2(18:2(9Z,12Z)/20:0) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(18:2(9Z,12Z)/20:0) → S-Adenosylhomocysteine + PC(18:2(9Z,12Z)/20:0) details
S-Adenosylmethionine + PE(18:2(9Z,12Z)/20:1(11Z)) → S-Adenosylhomocysteine + PE-NMe(18:2(9Z,12Z)/20:1(11Z)) details
PE-NMe(18:2(9Z,12Z)/20:1(11Z)) + S-Adenosylmethionine → PE-NMe2(18:2(9Z,12Z)/20:1(11Z)) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(18:2(9Z,12Z)/20:1(11Z)) → S-Adenosylhomocysteine + PC(18:2(9Z,12Z)/20:1(11Z)) details
S-Adenosylmethionine + PE(18:2(9Z,12Z)/22:0) → S-Adenosylhomocysteine + PE-NMe(18:2(9Z,12Z)/22:0) details
PE-NMe(18:2(9Z,12Z)/22:0) + S-Adenosylmethionine → PE-NMe2(18:2(9Z,12Z)/22:0) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(18:2(9Z,12Z)/22:0) → S-Adenosylhomocysteine + PC(18:2(9Z,12Z)/22:0) details
S-Adenosylmethionine + PE(18:2(9Z,12Z)/22:1(13Z)) → S-Adenosylhomocysteine + PE-NMe(18:2(9Z,12Z)/22:1(13Z)) details
PE-NMe(18:2(9Z,12Z)/22:1(13Z)) + S-Adenosylmethionine → PE-NMe2(18:2(9Z,12Z)/22:1(13Z)) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(18:2(9Z,12Z)/22:1(13Z)) → S-Adenosylhomocysteine + PC(18:2(9Z,12Z)/22:1(13Z)) details
S-Adenosylmethionine + PE(18:3(6Z,9Z,12Z)/18:3(6Z,9Z,12Z)) → S-Adenosylhomocysteine + PE-NMe(18:3(6Z,9Z,12Z)/18:3(6Z,9Z,12Z)) details
PE-NMe(18:3(6Z,9Z,12Z)/18:3(6Z,9Z,12Z)) + S-Adenosylmethionine → PE-NMe2(18:3(6Z,9Z,12Z)/18:3(6Z,9Z,12Z)) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(18:3(6Z,9Z,12Z)/18:3(6Z,9Z,12Z)) → S-Adenosylhomocysteine + PC(18:3(6Z,9Z,12Z)/18:3(6Z,9Z,12Z)) details
S-Adenosylmethionine + PE(18:3(6Z,9Z,12Z)/18:3(9Z,12Z,15Z)) → S-Adenosylhomocysteine + PE-NMe(18:3(6Z,9Z,12Z)/18:3(9Z,12Z,15Z)) details
PE-NMe(18:3(6Z,9Z,12Z)/18:3(9Z,12Z,15Z)) + S-Adenosylmethionine → PE-NMe2(18:3(6Z,9Z,12Z)/18:3(9Z,12Z,15Z)) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(18:3(6Z,9Z,12Z)/18:3(9Z,12Z,15Z)) → S-Adenosylhomocysteine + PC(18:3(6Z,9Z,12Z)/18:3(9Z,12Z,15Z)) details
S-Adenosylmethionine + PE(18:3(6Z,9Z,12Z)/20:0) → S-Adenosylhomocysteine + PE-NMe(18:3(6Z,9Z,12Z)/20:0) details
PE-NMe(18:3(6Z,9Z,12Z)/20:0) + S-Adenosylmethionine → PE-NMe2(18:3(6Z,9Z,12Z)/20:0) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(18:3(6Z,9Z,12Z)/20:0) → S-Adenosylhomocysteine + PC(18:3(6Z,9Z,12Z)/20:0) details
S-Adenosylmethionine + PE(18:3(6Z,9Z,12Z)/20:1(11Z)) → S-Adenosylhomocysteine + PE-NMe(18:3(6Z,9Z,12Z)/20:1(11Z)) details
PE-NMe(18:3(6Z,9Z,12Z)/20:1(11Z)) + S-Adenosylmethionine → PE-NMe2(18:3(6Z,9Z,12Z)/20:1(11Z)) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(18:3(6Z,9Z,12Z)/20:1(11Z)) → S-Adenosylhomocysteine + PC(18:3(6Z,9Z,12Z)/20:1(11Z)) details
S-Adenosylmethionine + PE(18:3(6Z,9Z,12Z)/22:0) → S-Adenosylhomocysteine + PE-NMe(18:3(6Z,9Z,12Z)/22:0) details
PE-NMe(18:3(6Z,9Z,12Z)/22:0) + S-Adenosylmethionine → PE-NMe2(18:3(6Z,9Z,12Z)/22:0) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(18:3(6Z,9Z,12Z)/22:0) → S-Adenosylhomocysteine + PC(18:3(6Z,9Z,12Z)/22:0) details
S-Adenosylmethionine + PE(18:3(6Z,9Z,12Z)/22:1(13Z)) → S-Adenosylhomocysteine + PE-NMe(18:3(6Z,9Z,12Z)/22:1(13Z)) details
PE-NMe(18:3(6Z,9Z,12Z)/22:1(13Z)) + S-Adenosylmethionine → PE-NMe2(18:3(6Z,9Z,12Z)/22:1(13Z)) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(18:3(6Z,9Z,12Z)/22:1(13Z)) → S-Adenosylhomocysteine + PC(18:3(6Z,9Z,12Z)/22:1(13Z)) details
S-Adenosylmethionine + PE(18:3(9Z,12Z,15Z)/18:3(9Z,12Z,15Z)) → S-Adenosylhomocysteine + PE-NMe(18:3(9Z,12Z,15Z)/18:3(9Z,12Z,15Z)) details
PE-NMe(18:3(9Z,12Z,15Z)/18:3(9Z,12Z,15Z)) + S-Adenosylmethionine → PE-NMe2(18:3(9Z,12Z,15Z)/18:3(9Z,12Z,15Z)) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(18:3(9Z,12Z,15Z)/18:3(9Z,12Z,15Z)) → S-Adenosylhomocysteine + PC(18:3(9Z,12Z,15Z)/18:3(9Z,12Z,15Z)) details
S-Adenosylmethionine + PE(18:3(9Z,12Z,15Z)/20:0) → S-Adenosylhomocysteine + PE-NMe(18:3(9Z,12Z,15Z)/20:0) details
PE-NMe(18:3(9Z,12Z,15Z)/20:0) + S-Adenosylmethionine → PE-NMe2(18:3(9Z,12Z,15Z)/20:0) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(18:3(9Z,12Z,15Z)/20:0) → S-Adenosylhomocysteine + PC(18:3(9Z,12Z,15Z)/20:0) details
S-Adenosylmethionine + PE(18:3(9Z,12Z,15Z)/20:1(11Z)) → S-Adenosylhomocysteine + PE-NMe(18:3(9Z,12Z,15Z)/20:1(11Z)) details
PE-NMe(18:3(9Z,12Z,15Z)/20:1(11Z)) + S-Adenosylmethionine → PE-NMe2(18:3(9Z,12Z,15Z)/20:1(11Z)) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(18:3(9Z,12Z,15Z)/20:1(11Z)) → S-Adenosylhomocysteine + PC(18:3(9Z,12Z,15Z)/20:1(11Z)) details
S-Adenosylmethionine + PE(18:3(9Z,12Z,15Z)/22:0) → S-Adenosylhomocysteine + PE-NMe(18:3(9Z,12Z,15Z)/22:0) details
PE-NMe(18:3(9Z,12Z,15Z)/22:0) + S-Adenosylmethionine → PE-NMe2(18:3(9Z,12Z,15Z)/22:0) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(18:3(9Z,12Z,15Z)/22:0) → S-Adenosylhomocysteine + PC(18:3(9Z,12Z,15Z)/22:0) details
S-Adenosylmethionine + PE(18:3(9Z,12Z,15Z)/22:1(13Z)) → S-Adenosylhomocysteine + PE-NMe(18:3(9Z,12Z,15Z)/22:1(13Z)) details
PE-NMe(18:3(9Z,12Z,15Z)/22:1(13Z)) + S-Adenosylmethionine → PE-NMe2(18:3(9Z,12Z,15Z)/22:1(13Z)) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(18:3(9Z,12Z,15Z)/22:1(13Z)) → S-Adenosylhomocysteine + PC(18:3(9Z,12Z,15Z)/22:1(13Z)) details
S-Adenosylmethionine + PE(20:0/20:0) → S-Adenosylhomocysteine + PE-NMe(20:0/20:0) details
PE-NMe(20:0/20:0) + S-Adenosylmethionine → PE-NMe2(20:0/20:0) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(20:0/20:0) → S-Adenosylhomocysteine + PC(20:0/20:0) details
S-Adenosylmethionine + PE(20:0/20:1(11Z)) → S-Adenosylhomocysteine + PE-NMe(20:0/20:1(11Z)) details
PE-NMe(20:0/20:1(11Z)) + S-Adenosylmethionine → PE-NMe2(20:0/20:1(11Z)) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(20:0/20:1(11Z)) → S-Adenosylhomocysteine + PC(20:0/20:1(11Z)) details
S-Adenosylmethionine + PE(20:0/22:0) → S-Adenosylhomocysteine + PE-NMe(20:0/22:0) details
PE-NMe(20:0/22:0) + S-Adenosylmethionine → PE-NMe2(20:0/22:0) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(20:0/22:0) → S-Adenosylhomocysteine + PC(20:0/22:0) details
S-Adenosylmethionine + PE(20:0/22:1(13Z)) → S-Adenosylhomocysteine + PE-NMe(20:0/22:1(13Z)) details
PE-NMe(20:0/22:1(13Z)) + S-Adenosylmethionine → PE-NMe2(20:0/22:1(13Z)) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(20:0/22:1(13Z)) → S-Adenosylhomocysteine + PC(20:0/22:1(13Z)) details
S-Adenosylmethionine + PE(20:1(11Z)/20:1(11Z)) → S-Adenosylhomocysteine + PE-NMe(20:1(11Z)/20:1(11Z)) details
PE-NMe(20:1(11Z)/20:1(11Z)) + S-Adenosylmethionine → PE-NMe2(20:1(11Z)/20:1(11Z)) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(20:1(11Z)/20:1(11Z)) → S-Adenosylhomocysteine + PC(20:1(11Z)/20:1(11Z)) details
S-Adenosylmethionine + PE(20:1(11Z)/22:0) → S-Adenosylhomocysteine + PE-NMe(20:1(11Z)/22:0) details
PE-NMe(20:1(11Z)/22:0) + S-Adenosylmethionine → PE-NMe2(20:1(11Z)/22:0) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(20:1(11Z)/22:0) → S-Adenosylhomocysteine + PC(20:1(11Z)/22:0) details
S-Adenosylmethionine + PE(20:1(11Z)/22:1(13Z)) → S-Adenosylhomocysteine + PE-NMe(20:1(11Z)/22:1(13Z)) details
PE-NMe(20:1(11Z)/22:1(13Z)) + S-Adenosylmethionine → PE-NMe2(20:1(11Z)/22:1(13Z)) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(20:1(11Z)/22:1(13Z)) → S-Adenosylhomocysteine + PC(20:1(11Z)/22:1(13Z)) details
S-Adenosylmethionine + PE(22:0/22:0) → S-Adenosylhomocysteine + PE-NMe(22:0/22:0) details
PE-NMe(22:0/22:0) + S-Adenosylmethionine → PE-NMe2(22:0/22:0) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(22:0/22:0) → S-Adenosylhomocysteine + PC(22:0/22:0) details
S-Adenosylmethionine + PE(22:0/22:1(13Z)) → S-Adenosylhomocysteine + PE-NMe(22:0/22:1(13Z)) details
PE-NMe(22:0/22:1(13Z)) + S-Adenosylmethionine → PE-NMe2(22:0/22:1(13Z)) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(22:0/22:1(13Z)) → S-Adenosylhomocysteine + PC(22:0/22:1(13Z)) details
S-Adenosylmethionine + PE(22:1(13Z)/22:1(13Z)) → S-Adenosylhomocysteine + PE-NMe(22:1(13Z)/22:1(13Z)) details
PE-NMe(22:1(13Z)/22:1(13Z)) + S-Adenosylmethionine → PE-NMe2(22:1(13Z)/22:1(13Z)) + S-Adenosylhomocysteine details
S-Adenosylmethionine + PE-NMe2(22:1(13Z)/22:1(13Z)) → S-Adenosylhomocysteine + PC(22:1(13Z)/22:1(13Z)) details
PE(16:0/16:0) → PC(16:0/16:0) details
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 19
Locus Not Available
SNPs PEMT
Gene Sequence
>600 bp
ATGACCCGGCTGCTTGGCTACGTGGACCTCTCGGAACCCCACTTTGTGGCTGCTGTCCTT
GCCATTGTCTTCAATCCGCTCTTCTGGAATGTGGTTGCGAGATGGGAACACAAGACCCGA
AAGCTGAGCAAGGCCTTTGGGTCCCCCCGCCTGGCCTGTTACACCCTGGGTGGGGCCATC
CTGCTCTTGAACGTCCTGCGCTCCCACTGCTTCACGCAGGCCATGCTGAGCCAGCCCCGG
ATGCAGAGCCTGGACAACCCCGCGGTCTACCACGTGGGCCTGGCACTCCTGGGAGTGGGT
GGCGTGTTCGTCCTTTCCAGTTTCCTGGCGCTGGGCTTCACCGGGACCTTCCTAGGCGAC
TACTTCGGGATCCTCAAGGAGGCCAGAGTGACCATGTTCCCGTTCAGCGTCCTGGACAAC
CCCATGTACTGGGGCAGCACAGCCATCTACCTGGGCTGGGCCATTGTGCACGCCAGCCCC
ACCGGCCTGCTGCTGACCGCGCTGGTGGCGCTCATCTACATGGTCGCCATCGTGTATGAA
GAGCCCTTCACTGCCGAAATCTATCAGCAGAAAGCCTCCCAGGCCTACAAGAGGAGCTGA
Protein Properties
Number of Residues 199
Molecular Weight 22018.0
Theoretical pI 9.27
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • 46-66
  • 94-114
  • 158-178
Protein Sequence
>Phosphatidylethanolamine N-methyltransferase
MTRLLGYVDLSEPHFVAAVLAIVFNPLFWNVVARWEHKTRKLSKAFGSPRLACYTLGGAI
LLLNVLRSHCFTQAMLSQPRMQSLDNPAVYHVGLALLGVGGVFVLSSFLALGFTGTFLGD
YFGILKEARVTMFPFSVLDNPMYWGSTAIYLGWAIVHASPTGLLLTALVALIYMVAIVYE
EPFTAEIYQQKASQAYKRS
GenBank ID Protein AAQ01191.1
UniProtKB/Swiss-Prot ID Q7YRH6
UniProtKB/Swiss-Prot Entry Name PEMT_BOVIN
PDB IDs Not Available
GenBank Gene ID AY334572
GeneCard ID PEMT
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available